ELISA Kits

Showing 151–300 of 3623 results

  • Aldosterone, a steroid hormone secreted by the adrenal cortex, is the principle mineralocorticoid controlling sodium and potassium balance. Serum aldosterone levels in normal upright adult individuals are generally less than 300 pg/ml. Only a fraction of urinary aldosterone is excreted intact, thus urinary excretion of aldosterone in normal adults is typically assessed as a combination of free aldosterone and aldosterone-18-glucuronide and is generally less than 20 µg/24 hr. Cayman’s Aldosterone ELISA Kit is a competitive assay that can be used for quantification of aldosterone in serum, plasma, urine, and other sample matrices. The assay has a range from 15.6-2,000 pg/ml and a sensitivity (80% B/B0) of approximately 30 pg/ml.  

     

    Brand:
    Cayman
    SKU:501090 - 96 wells

    Available on backorder

  • Brand:
    Cayman
    SKU:401094 - 100 ng

    Available on backorder

  • Cayman’s Alkaline Phosphatase (ALP) Colorimetric Activity Assay Kit provides a convenient method of measuring ALP activity in serum, plasma, tissue samples, and cell lysates with a limit of detection of 0.5 U/L. Measurement of ALP activity is carried out by monitoring the dephosphorylation of the chromogenic substrate p-nitrophenyl phosphate (pNPP). In the first step, ALP dephosphorylates pNPP generating p-nitrophenol. In the second step, the phenolic hydroxyl group is deprotonated under alkaline conditions resulting in p-nitrophenolate, which yields an intense yellow color that can be measured using absorbance at 405 nm. Under circumstances in which ALP activity is rate limiting, the increase in absorbance at 405 nm is directly proportional to ALP activity in the sample.  

     

    Brand:
    Cayman
    SKU:701710 - 480 wells

    Available on backorder

  • ALP Assay Buffer has been tested and formulated to work exclusively with Cayman’s Alkaline Phosphatase Colorimetric Activity Assay Kit (Item No. 701710). Please visit Alkaline Phosphatase Colorimetric Activity Assay Kit (Item No. 701710) for the kit protocol, procedures, and product handling.  

     

    Brand:
    Cayman
    SKU:400083 - 30 ml

    Available on backorder

  • Brand:
    Cayman
    SKU:700261 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:700263 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:700264 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:700265 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:700262 - 1 ea

    Available on backorder

  • α-methylacyl-Coenzyme A (α-methylacyl-CoA) racemase (AMACR), is an enzyme involved in the metabolism of branched chain fatty acids and 2-arylpropanoic acids (2-APAs), such as ibuprofen (Item No. 70280).{60129} It is expressed in most human tissues and is localized to peroxisomes and mitochondria.{60129,60130} AMACR converts R-2-methyl fatty acids to S-2-methylacyl-CoA esters via an epimerization reaction prior to their degradation by β-oxidation.{60129} AMACR is overexpressed in localized and metastatic prostate cancer, as well as in a variety of other cancers.{60131} AMACR has been found selectively in patient-derived prostate cancer tumor tissue compared to non-cancer prostate tissue, and has been used as a biomarker of the disease.{60132} Mutations in AMACR resulting in reduced enzyme activity lead to the accumulation of R-2-methyl fatty acids and are associated with neurological and peroxisomal disorders.{60133} Cayman’s AMACR (N-Term) Rabbit Monoclonal Antibody can be used for immunohistochemistry (IHC) and Western blot (WB) applications.  

     

    Brand:
    Cayman
    SKU:32274 - 100 µl

    Available on backorder

  • Amyloid plaques composed primarily of the 42 amino acid form of amyloid-β peptide (Aβ42) are a hallmark of Alzheimer’s disease (AD). However, the roles of the various amyloid β peptide(s), especially Aβ42, related to the neurotoxicity characteristic of AD remains unclear. A major hindrance to evaluating the role of Aβ in AD pathology has been the availability of anti-Aβ antibodies to selectively detect Aβ versus amyloid precursor protein (APP), Aβ40 versus Aβ42, and specific conformations of the peptide, particularly oligomeric forms. MOAB-2 (mouse IgG2b) is a pan-specific antibody specific to Aβ (residues 1-4) that differentiates intracellular Aβ from APP. MOAB-2 does not detect APP in cell culture media/lysates or in brain homogenates from transgenic mice expressing 5 familial AD mutation (5xFAD mice). Intraneuronal Aβ was confirmed by co-localization of MOAB-2 immunoreactivity with C-terminal antibodies specific for Aβ40 and Aβ42, and with cathepsin-D, a lysosomal marker. Additionally, MOAB-2 demonstrates strong intraneuronal and extra-cellular immunoreactivity in 5xFAD and 3xTg mouse brain tissues.{20683}  

     

    Brand:
    Cayman
    SKU:11610 - 200 µg

    Available on backorder

  • Androgen receptor is a ligand-activated transcription factor and member of the steroid hormone receptor family.{59547,59546} It is composed of an N-terminal regulatory domain (AF-1 site), a DNA-binding domain that contains two zinc fingers, a hinge region containing a nuclear localization signal, and a C-terminal ligand binding domain (AF-2 site). Unligated androgen receptors are localized to the cytoplasm and bound to heat shock protein23 (Hsp23), -56, -70, and -90 in a stable conformation that facilitates androgen binding. Androgen binding induces dissociation of the Hsps and nuclear translocation of the androgen receptor where it binds to androgen response elements (AREs) and induces gene transcription. Mutations in AR, the gene encoding the androgen receptor, induce abnormalities in male development ranging from partial androgen insensitivity to complete male-to-female phenotypic sex reversal.{59546} Androgen receptor knockdown induces bone loss, complete loss of sexual behaviors, and reduced aggressive behaviors in male mice, as well as defective folliculogenesis and reduced fertility in female mice. Expression of C-terminally truncated and constitutively active androgen receptor mutants is associated with reduced progression-free survival, lower prostate-specific androgen (PSA) response rates, and shorter median overall survival in patients with castration-resistant prostate cancer.{59548} Cayman’s Androgen Receptor (N-Term) Rabbit Monoclonal Antibody can be used for immunohistochemistry (IHC) and Western blot (WB) applications. The antibody recognizes the N-terminus to detect the full-length androgen receptor and its splice variants from human samples.  

     

    Brand:
    Cayman
    SKU:32206 - 100 µl

    Available on backorder

  • The androgen receptor (AR) is an ~100 kDa androgen-dependent transcription factor that is a member of the steroid/nuclear receptor gene superfamily. The AR signaling pathway plays a key role in development and function of male reproductive organs, including the prostate and epididymis. AR also plays a role in nonreproductive organs, such as muscle, hair follicles, and brain. Abnormalities in the AR signaling pathway have been linked to a number of diseases, including prostate cancer, Kennedy’s disease, and male infertility. The phosphatidylinositol 3-kinase (PI3K)/Akt signaling pathway plays an important role in regulating AR activity through phosphorylation of AR at Ser213/210 and Ser791/790. Growth factors or cytokines may induce phosphorylation of AR through the PI3K/Akt pathway. IGF-1 activates the PI3K/AKT pathway in LNCap at high passage number and increases phosphorylation of the AR at Ser213/210 and Ser791/790.{17381} The western blot results also show that inhibition of the PI3K/Akt pathway by LY294002 prior to incubation with IGF-1 suppressed AR phosphorylation at Ser213/210. Activation of the PI3K/Akt pathway is thought to have a survival role in prostate cancer by protecting cells from apoptosis.  

     

    Brand:
    Cayman
    SKU:13492 - 1 ea

    Available on backorder

  • Angiotensin II is a primary reactive vasoconstrictor, the main stimulus for aldosterone release, and one of the causative factors of chronic hypertension. The active angiotensin II octapeptide is released via a tightly controlled series of prohormones and proteases as diagrammed below. Normal human plasma angiotensin II levels are from 10-30 pg/ml when measured at rest in the supine position; they increase on standing, exercise, dehydration, or sodium depletion. The unique, patented ‘Immobilized Antigen’ technology of this angiotensin II immunometric assay allows reliable detection of 1-2 pg/ml, or as little as 10% of the normal human plasma concentration. [Bertin Catalog No. A05880]  

     

    Brand:
    Cayman
    SKU:589301 - 96 wells

    Available on backorder

  • ANGPTL3 regulates angiogenesis and also directly regulates lipid, glucose, and energy metabolism. ANGPTL3 (human) monoclonal antibody (clone Kairos-37) recognizes the fibrinogen-like domain (FLD) of human ANGPTL3. It detects a band of ~68 kDa and a cleaved band of ~35 kDa by WB. It does not cross-react with other ANGPTL family proteins.  

     

    Brand:
    Cayman
    SKU:10805 - 100 µg

    Available on backorder

  • ANGPTL3 regulates angiogenesis and also directly regulates lipid, glucose, and energy metabolism. ANGPTL3 (human) monoclonal antibody (clone Kairos-37) recognizes the fibrinogen-like domain (FLD) of human ANGPTL3. It detects a band of ~68 kDa and a cleaved band of ~35 kDa by WB. It does not cross-react with other ANGPTL family proteins.  

     

    Brand:
    Cayman
    SKU:10805 - 50 µg

    Available on backorder

  • ANGPTL3 regulates angiogenesis and also directly regulates lipid, glucose, and energy metabolism. ANGPTL3 (mouse) monoclonal antibody (clone Kairos3-1541) recognizes mouse ANGPTL3. It detects a band of ~69 kDa by WB.  

     

    Brand:
    Cayman
    SKU:10806 - 100 µg

    Available on backorder

  • ANGPTL3 regulates angiogenesis and also directly regulates lipid, glucose, and energy metabolism. ANGPTL3 (mouse) monoclonal antibody (clone Kairos3-1541) recognizes mouse ANGPTL3. It detects a band of ~69 kDa by WB.  

     

    Brand:
    Cayman
    SKU:10806 - 50 µg

    Available on backorder

  • ANGPTL3 regulates angiogenesis and also directly regulates lipid, glucose, and energy metabolism. ANGPTL3 (mouse) monoclonal antibody (clone Kairos3-3741) recognizes mouse ANGPTL3. It detects a band of ~69 kDa by WB and cross-reacts with mouse ANGPTL3 fibrinogen-like domain (FLD).  

     

    Brand:
    Cayman
    SKU:10807 - 100 µg

    Available on backorder

  • ANGPTL3 regulates angiogenesis and also directly regulates lipid, glucose, and energy metabolism. ANGPTL3 (mouse) monoclonal antibody (clone Kairos3-3741) recognizes mouse ANGPTL3. It detects a band of ~69 kDa by WB and cross-reacts with mouse ANGPTL3 fibrinogen-like domain (FLD).  

     

    Brand:
    Cayman
    SKU:10807 - 50 µg

    Available on backorder

  • Cayman’s Annexin A1 (human) ELISA Kit is a sandwich assay which can be used to measure human annexin A1 in tissue culture media, serum and plasma. The standard curve spans the range of 0.20 – 20 ng/ml. Annexin A1 is a natural anti-inflammatory protein produced by neutrophils and monocytes. The glucocorticoid-induced production and release of annexin A1 is the primary means by which glucocorticoids function as anti-inflammatory agents. Annexin A1 inhibits the synthesis of pro-inflammatory eicosanoids by suppressing the function of secretory phospholipase A2 (sPLA2). This, in turn, limits the recruitment of neutrophils into inflammatory sites and down-regulates the production of pro-inflammatory mediators by those neutrophils that enter inflammatory sites. Annexin A1 also functions in the resolution of inflammation by inducing neutrophil apoptosis, and promoting neutrophil clearance (efferocytosis) by macrophages. The pro-resolving functions of annexin A1 are mediated via binding to FPR2/ALX, a receptor it shares with the specific pro-resolving mediators lipoxin A4 (LXA4) and resolvin D1 (RvD1).  

     

    Brand:
    Cayman
    SKU:501550 - 96 wells

    Available on backorder

  • Annexins are a superfamily of 13 proteins sharing a high degree of homology. They have in common a core C-terminal domain containing calcium and phospholipid binding motifs, allowing most of them to bind to phospholipid membranes in a calcium-dependent manner. The N-terminal domains vary between family members and provide a unique function.{30992}Annexin A1 is an endogenous mediator of inflammation, promoting resolution in a number of ways. Normally expressed in intracellular compartments, it is drawn to the cell membrane and both induced and externalized by glucocorticoid response pathways.{30993,30994} The glucocorticoid-induced production and release of annexin A1 is the primary means by which glucocorticoids function as anti-inflammatory agents. Annexin A1 inhibits the synthesis of pro-inflammatory eicosanoids by suppressing the function of sPLA2. This, in turn, limits the recruitment of neutrophils into inflammatory sites and downregulates the production of pro-inflammatory mediators by those neutrophils that enter inflammatory sites.{30995} Meanwhile, proteolytic fragments generated in response to increased expression are implicated in producing a marker for phagocytosis.{30996} Annexin A1 also functions in the resolution of inflammation by inducing neutrophil apoptosis, and promoting neutrophil clearance (efferocytosis) by macrophages. The pro-resolving functions of annexin A1 are mediated via binding to FPR2/ALX, a receptor it shares with the specific pro-resolving mediators lipoxin A4 (Item No. 90410) and resolvin D1 (Item No. 10012554).{30995} The molecule’s regulatory role has led to investigation of the downstream effects of annexin A1, including cancer, adaptive immunity, and wound repair.{30997,30998,30999} The predicted size of annexin A1 is 38.7 kDa and Cayman’s Annexin A1 Monoclonal Antibody (Clone 3F5) detects a size 39 kDa band via western blot.  

     

    Brand:
    Cayman
    SKU:19707 - 500 µg

    Available on backorder

  • Annexins are a superfamily of 13 proteins sharing a high degree of homology. They have in common a core C-terminal domain containing calcium and phospholipid binding motifs, allowing most of them to bind to phospholipid membranes in a calcium-dependent manner. The N-terminal domains vary between family members and provide unique function.{30992} Annexin A1 is an endogenous mediator of inflammation, promoting resolution in a number of ways. Normally expressed in intracellular compartments, it is drawn to the cell membrane and both induced and externalized by glucocorticoid response pathways.{30993,30994} The glucocorticoid-induced production and release of annexin A1 is the primary means by which glucocorticoids function as anti-inflammatory agents. Annexin A1 inhibits the synthesis of pro-inflammatory eicosanoids by suppressing the function of sPLA2. This, in turn, limits the recruitment of neutrophils into inflammatory sites and down-regulates the production of pro-inflammatory mediators by those neutrophils that enter inflammatory sites.{30995} Meanwhile, proteolytic fragments generated in response to increased expression are implicated in producing a marker for phagocytosis.{30996} Annexin A1 also functions in the resolution of inflammation by inducing neutrophil apoptosis, and promoting neutrophil clearance (efferocytosis) by macrophages. The pro-resolving functions of annexin A1 are mediated via binding to FPR2/ALX, a receptor it shares with the specific pro-resolving mediators lipoxin A4 (LXA4; Item No. 90410) and resolvin D1 (RvD1; Item No. 10012554).{30995} The molecule’s regulatory role has led to investigation of the downstream effects of annexin A1, including cancer, adaptive immunity, and wound repair.{30997,30998,30999} The predicted size of annexin A1 is 38.7 kDa and Cayman’s Annexin A1 Polyclonal Antibody detects a size 39 kDa band via Western blot and Immunoprecipitation.  

     

    Brand:
    Cayman
    SKU:19708 - 100 µg

    Available on backorder

  • Cayman’s Annexin V APC Assay Kit employs an APC-conjugated annexin V as a probe for phosphatidylserine on the outer membrane of apoptotic cells. DAPI is used as a marker of cell membrane permeability seen in very late apoptotic or necrotic cells. This kit is valuable for researchers looking to assess the degree of apoptosis induced by experimental compounds, and can be useful in pharmacology, immunology, cancer, or physiology research.  

     

    Brand:
    Cayman
    SKU:601410 - 100 tests

    Available on backorder

  • One of the hallmarks of the early stages of apoptosis is the redistribution of membrane phospholipids such as phosphatidylserine and phosphatidylethanolamine from the inner to outer leaflet of the membrane bilayer where they are exposed on the cell surface. Externalization of phosphatidylserine residues to the outer plasma membrane leaflet allows their detection via their high affinity for annexin V, a phospholipid binding protein. Cayman’s Annexin V Assay Kit employs a FITC-conjugated Annexin V as a probe for phosphatidylserine on the outer membrane of apoptotic cells. Apoptotic cells bound with fluorochrome-labeled Annexin V can be visualized using fluorescence microscopy or flow cytometry. The reagents provided in the kit are sufficient to run 500 samples when using a 96-well plate format.  

     

    Brand:
    Cayman
    SKU:600300 - 100 tests

    Available on backorder

  • Cayman’s Annexin V PE Assay Kit employs a PE-conjugated annexin V as a probe for phosphatidylserine on the outer membrane of apoptotic cells. DAPI is used as a marker of cell membrane permeability seen in very late apoptotic or necrotic cells. This kit is valuable for researchers looking to assess the degree of apoptosis induced by experimental compounds, and can be useful in pharmacology, immunology, cancer, or physiology research.  

     

    Brand:
    Cayman
    SKU:601420 - 100 tests

    Available on backorder

  • 5-Hydroxymethylcytosine (5-hmC) is an epigenetic modification formed from the oxidation of 5-methylcytosine by Tet dioxygenases.{17171} 5-hmC is primarily a stable DNA modification, but it can be oxidized by Tet enzymes and its products further modified to generate nonmethylated cytosine, indicating a role as an intermediate in DNA demethylation as well.{49667,29364,49668} It is associated with actively transcribed genes and recognized by a variety of proteins, including proteins involved in DNA repair and DNA metabolic processes.{49667,49668} 5-hmC has been found in all mammalian tissues but levels are higher in the brain relative to other tissues.{49669} The percentage of genomic 5-hmC in mouse cerebellum increases during postnatal development until adulthood, and genes acquiring intragenic 5-hmC are enriched in pathways associated with age-related neurodegenerative disease pathways in adult mice.{20327} In contrast, 5-hmC levels are reduced by up to 8-fold in cancer tissues.{49667,49670} Cayman’s 5-Hydroxymethylcytosine Polyclonal Antibody can be used for dot blot, ELISA, hydroxymethylated DNA immunoprecipitation (hMeDIP), immunocytochemistry (ICC), and immunohistochemistry (IHC) applications.  

     

    Brand:
    Cayman
    SKU:20723 - 50 µg

    Available on backorder

  • DNA methylation of cytosine to 5-methyl cytosine (5-mC) is an epigenetic mark that is relatively common in both plants and mammals and plays a role in transcriptional and chromatin regulation. In healthy cells, DNA methylation occurs at CpG sites, but CpG islands are generally not modified. However, tumor cells show an increase in CpG island methylation and a decrease in individual CpG sites.{27017} This ‘hypo-methylation’ can lead to aberrant activation of genes. Anti-5-methyl Cytosine Rabbit Monoclonal Antibody (Clone RM231) is a probe for immunochemical detection of 5-methyl cytosine by methylated DNA immunoprecipitation, IHC, ICC, ELISA, or dot blot.  

     

    Brand:
    Cayman
    SKU:20722 - 50 µg

    Available on backorder

  • Carbamylation is a non-enzymatic and irreversible post-translational modification whereby cyanate reacts with lysine residues within polypeptide chains to generate ε-carbamyl-lysine (homocitrulline).{34533} Cyanate originates from the decomposition of urea and exists in equilibrium with its reactive form isocyanic acid.{34532} Neutrophil-derived MPO mediates the conversion of thiocyanate to isocyanate at sites of inflammation.{34533,34534} Increased levels of urea associated with chronic kidney disease result in elevated cyanate concentrations and a higher potential for carbamylated proteins.{34535} The presence of carbamylated proteins has been associated with rheumatoid arthritis.{34536} Homocitrulline residues are structurally similar to citrulline, the presence of an additional methylene group on homocitrulline being the only difference. Peptidylarginine deiminase (PAD)-catalyzed formation of citrulline residues on proteins and peptides can indicate many of the same disease states as the presence of homocitrulline residues. The ability to differentiate between citrullinated and carbamylated proteins has been difficult using traditional techniques. Cayman’s Anti-Carbamylation (Homocitrulline) Monoclonal Antibody specifically detects carbamylated proteins and does not detect the unmodified or citrullinated counterparts.  

     

    Brand:
    Cayman
    SKU:23203 - 100 µg

    Available on backorder

  • Cayman’s Anti-Carbamylation (Homocitrulline) Polyclonal Antibody specifically detects carbamylated proteins and does not detect the unmodified or citrullinated counterparts. It has been tested for ELISA, Immunoprecipitation, and Western blot applications. Carbamylation is the non-enzymatic and irreversible post-translational modification whereby cyanate reacts with lysine residues within polypeptide chains to generate ε-carbamyl-lysine (homocitrulline).{34533} Cyanate originates from the decomposition of urea and exists in equilibrium with its reactive form isocyanic acid.{34532} Neutrophil derived MPO mediates the conversion of isocyanate from thiocyanate at sites of inflammation.{34533,34534} Increased levels of urea associated with chronic kidney disease result in elevated cyanate concentrations, and a higher potential for carbamylated proteins.{34535} The presence of carbamylated proteins has been associated with rheumatoid arthritis.{34536} Homocitrulline residues are structurally similar to citrulline; the presence of an additional methylene group on homocitrulline being the only difference. Peptidyl arginine deiminase (PAD) mediated citrulline residues on proteins and peptides can indicate many of the same disease states as the presence of homocitrulline residues. The ability to differentiate between citrullinated and carbamylated proteins has been difficult using traditional techniques.  

     

    Brand:
    Cayman
    SKU:22428 - 1 ea

    Available on backorder

  • Anti-cholera toxin B subunit (goat) is a polyclonal anti-choleragenoid from goat that is suitable for use in toxin neutralization and binding assays or for immunohistochemical studies in conjunction with the cholera toxin B subunit. The pentameric B subunit of cholera toxin (Item No. 19654) binds with high efficiency to GM1 monosialoganglioside cell membrane receptors found on mammalian cell surfaces and facilitates entrance of the A subunit into cells.{31319} The cholera toxin B subunit is often used for retrograde track tracing studies in neuroscience research.{31321}  

     

    Brand:
    Cayman
    SKU:19655 - 100 µL

    Available on backorder

  • Immunization of mice with citrullinated human fibrinogen, especially mice expressing the human HLA-DR4 transgene, induces an arthritic response driven by the production of antibodies that recognize citrullinated epitopes. The polyclonal antibody response produces antibodies reactive with both citrullinated human fibrinogen and unmodified, noncitrullinated human fibrinogen. Cayman’s Anti-Citrullinated Human Fibrinogen Assay (mouse) is an immunometric (sandwich) assay that can be used to distinguish the antibody response to citrullinated human fibrinogen from the antibody response to unmodified human fibrinogen in mouse serum or plasma. A human fibrinogen affinity sorbent is provided with the kit so that any antibodies capable of reacting with non-citrullinated (unmodified) fibrinogen can be removed prior to analysis of the remaining anti-citrullinated fibrinogen antibodies for an accurate analysis of the anti-citrulline response. This kit uses a citrullinated human fibrinogen-coated plate and a detection antibody recognizing mouse IgG. An anti-citrullinated human fibrinogen monoclonal antibody is included as a standard. The standard curve spans the range of 0.15 to 10 µg/ml, with an an LLOQ of 0.15 µg/ml.  

     

    Brand:
    Cayman
    SKU:501270 - 96 wells

    Available on backorder

  • Citrulline is a noncoding amino acid that is produced by deimination of arginine through the post-translational modification citrullination.{56025} Citrullination is catalyzed by protein arginine deiminases (PADs) that convert positively charged arginine to electrically neutral citrulline, decreasing the isoelectric point of the protein, altering the native protein structure, and influencing protein ionic interactions.{56026} Protein citrullination has roles in many physiological and pathological processes, including autoimmunity, cancer, and neurodegenerative disorders.{56027} Citrullination of arginine 26 on histone H3 by PAD2 (Item No. 10785) displaces histone H3 from chromatin, resulting in chromatin decondensation and estrogen receptor α (ERα) transcriptional activation in a reporter assay.{30729} Citrullinated histones are also a component of neutrophil extracellular traps (NETs), a network of decondensed DNA and intracellular proteins secreted by neutrophils as a pathogen defense mechanism that is also a source of citrullinated autoantigens.{25917} Increased levels of antibodies to citrullinated protein antigens (ACPAs) are associated with increased disease severity in patients with rheumatoid arthritis.{56028} Plasma levels of citrullinated histone H3 are increased in patients with advanced cancer, and citrullinated glial fibrillary acidic protein (citGFAP; Item No. 28622) has been found in postmortem hippocampus from patients with Alzheimer’s disease.{56029,53021} Cayman’s Anti-Citrulline Monoclonal Antibody (Clone 1D9) can be used for ELISA, immunohistochemistry (IHC), and immunoprecipitation (IP) applications.  

     

    Brand:
    Cayman
    SKU:30773 - 100 µg

    Available on backorder

  • 2,4-Dinitrophenol (DNP) is a hapten that induces a strong immune response when attached to proteins or peptides.{48325,48326} DNP can be incorporated at protein carbonyls via covalent linkage of DNP to carbonyl groups using 2,4-dinitrophenylhydrazine (DNPH) or through site-specific incorporation of unnatural amino acids that contain a DNP functional group.{48327,48325} Immunization with DNP-modified proteins or tumor cells induces antibody formation in vivo and has been used in the design of vaccines for clearance of disease-causing cells or viruses and induction of autoimmune diseases such as colitis and thyroiditis in various animal models.{48328,48329} Cayman’s Anti-DNP Monoclonal Antibody can be used for ELISA, Western blot, and immunoprecipitation applications.  

     

    Brand:
    Cayman
    SKU:25863 - 100 µg

    Available on backorder

  • 2,4-Dinitrophenol (DNP) is a hapten that induces a strong immune response when attached to proteins or peptides.{48325,48326} DNP can be incorporated at protein carbonyls via covalent linkage of DNP to carbonyl groups using 2,4-dinitrophenylhydrazine (DNPH) or through site-specific incorporation of unnatural amino acids that contain a DNP functional group.{48325,48327} Immunization with DNP-modified proteins or tumor cells induces antibody formation in vivo and has been used in the design of vaccines for clearance of disease-causing cells or viruses and induction of autoimmune diseases such as colitis and thyroiditis.{48328,48329} Cayman’s Anti-DNP Polyclonal Antibody can be used for ELISA, Western blot, and immunoprecipitation applications.  

     

    Brand:
    Cayman
    SKU:25864 - 500 µL

    Available on backorder

  • Brand:
    Cayman
    SKU:483152 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:483152 - 5 ea

    Available on backorder

  • Anti-EP4 (Prostaglandin E4) receptor (C-term) conjugated to SureLight® APC Antibody: Rabbit anti-EP4 receptor (C-term) IgG Specificity: EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Reactivity: Human, murine, rat, and ovine EP4 receptor; non-reactive with EP1, EP2, and EP3 receptors; other species not tested. Dye: SureLight® Allophycocyanin (APC) Excitation max. λ: 650 nm Emission max. λ: 660 nm Uses: Flow cytometry and cell-based assays  

     

    Brand:
    Cayman
    SKU:16625 - 50 µg

    Available on backorder

  • Anti-His-HRP Conjugate has been tested and formulated to work with Cayman’s Kits. Detailed instructions for its use are contained in the respective Cayman Kit booklet.  

     

    Brand:
    Cayman
    SKU:402054 - 360 µl

    Available on backorder

  • Anti-His-tag Rabbit Monoclonal Antibody (Clone RM146) is a probe for immunochemical detection of His tags on recombinant proteins by western blot, immunoprecipitation, immunohistochemistry, immunocytochemistry, or flow cytometry. Recombinant proteins are routinely labeled with affinity tags, such as poly-histidine (poly-His), to facilitate both their detection and purification. Poly-His tags are often the tag of choice due to their small size, less potential to interfere in protein folding, weak immunogenicity, and high affinity for Ni2+.  

     

    Brand:
    Cayman
    SKU:20725 - 100 µg

    Available on backorder

  • Histone H3 is a nuclear protein and a component of the nucleosome core, a basic unit of chromatin, that is essential for organizing genomic DNA in eukaryotic nuclei.{57056} It is a globular protein that contains an unstructured N-terminal tail that extends outside of the nucleosome core and is subject to various post-translational modifications (PTMs), including methylation, phosphorylation, acetylation, and citrullination.{57056,53978} Histone H3 PTMs function as epigenetic regulators of gene transcription by affecting chromatin structure and providing binding sites for many transcription factors, thus regulating several cellular functions including gene expression, cell cycle, and DNA replication and repair.{57056,56203} Differential methylation of histone H3 at various lysine residues is catalyzed by SET domain-containing methyltransferases and marks sites of transcriptional activation or repression.{57056} Citrullination of histone H3 by protein arginine deiminase 4 (PAD4; Item Nos. 10500 | 25915 | 28910) or PAD2 (Item No. 10785) induces the release of neutrophil extracellular traps (NETs), a network of decondensed DNA and intracellular proteins secreted by neutrophils as a pathogen defense mechanism.{52711,52712} Histone H3 mutations have been found in patients with diffuse intrinsic pontine glioma, leukemia, or chondroblastoma.{52713,49724} Cayman’s Anti-Histone H3 pan Rabbit Monoclonal Antibody (Clone RM188) can be used for ELISA, immunocytochemistry (ICC), multiplex-based assays, and Western blot (WB) applications. The antibody recognizes all histone H3 proteins independent of post-translational modifications.  

     

    Brand:
    Cayman
    SKU:20724 - 100 µg

    Available on backorder

  • Anti-HLA-DR (α and β chains) ELISA Strip Plate has been tested and formulated to work exclusively with Cayman’s HLA-DR (α and β chains) ELISA Kit (Item No. 501810). Please visit HLA-DR (α and β chains) ELISA Kit (Item No. 501810) for the kit protocol, procedures, and product handling.  

     

    Brand:
    Cayman
    SKU:480130 - 1 ea

    Available on backorder

  • Anti-HLA-DR (α and β chains) HRP Conjugate has been tested and formulated to work exclusively with Cayman’s HLA-DR (α and β chains) ELISA Kit (Item No. 501810). Please visit HLA-DR (α and β chains) ELISA Kit (Item No. 501810) for the kit protocol, procedures, and product handling.  

     

    Brand:
    Cayman
    SKU:480132 - 1.5 ml

    Available on backorder

  • Brand:
    Cayman
    SKU:400912 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:400962 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:400922 - 1 ea

    Available on backorder

  • The Anti-Inflammatory Screening Library consists of 3 plates and contains approximately 235 anti-inflammatory and related compounds in a 96-well Matrix™ tube rack format as 10 mM stock solutions in DMSO. This library includes inhibitors of pro-inflammatory cytokine production, macrophage and T cell activation, cytokine storm receptor signaling, the NLRP3 inflammasome, NF-κB signaling, and kinases involved in canonical and non-canonical inflammatory signaling pathways. It also includes corticosteroids, glucocorticoids, and inhibitors of enzymes involved in inflammatory lipid mediator production and metabolism, such as COX-1 and COX-2, 5-lipoxygenase (5-LO), microsomal prostaglandin E synthase-1 (mPGES-1), cytosolic phospholipase A2 (cPLA2), and soluble epoxide hydrolase (sEH). Additional targets include enzymes and receptors involved in NETosis, coagulation, and platelet aggregation. Please review the product insert for a full list of targets. Stability data is not available for the compounds as supplied in the screening library.  

     

    Brand:
    Cayman
    SKU:31530 - 50 µl

    Available on backorder

  • Brand:
    Cayman
    SKU:483302 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:483302 - 5 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:483312 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:483312 - 5 ea

    Available on backorder

  • Immunization of mice with chicken egg albumin (ovalbumin/OVA) in a precipitate complex with aluminum hydroxide (alum) is a highly effective means of inducing a potent TH2-mediated immune response. OVA/alum immunized mice produce anti-OVA antibodies predominantly of the IgG1 and IgE isotypes that mediate tissue-specific effector functions in multiple mouse models of chronic inflammation, including allergic asthma, allergic rhinitis, and cutaneous hypersensitivity. When using one of these models, it is often desirable to measure anti-OVA antibody levels in the plasma or serum to determine the effectiveness of the immunization, the activity of a drug, or the effect of a specific gene deletion. The plasma concentration of OVA-specific IgG1, the predominant anti-OVA immunoglobulin isotype found in the serum or plasma of mice immunized with OVA/alum, is typically 1,000-fold greater than that of OVA-specific IgE. Cayman’s Anti-Ovalbumin IgE (mouse) ELISA Kit is an immunometric assay which can be used to measure anti-ovalbumin of the IgE isotype in mouse plasma and serum without prior sample purification. A plate-bound antibody specific for mouse IgE is used to selectively measure ovalbumin-specific IgE, total plasma or serum IgE, which avoids interference from IgG1 binding. A biotin-labeled ovalbumin reagent is then added to quantify the ovalbumin-specific subset of this captured IgE. A monoclonal anti-ovalbumin IgE produced from mice immunized with OVA/alum is used as the standard. The standard curve spans the range of 1.56-100 ng/ml, with an LLOQ of 3.12 ng/ml.  

     

    Brand:
    Cayman
    SKU:500840 - 96 wells

    Available on backorder

  • Brand:
    Cayman
    SKU:400844 - 200 ng

    Available on backorder

  • Cayman’s Anti-Ovalbumin IgG1 (mouse) ELISA Kit is an immunometric (i.e., ‘sandwich’) assay which can be used to measure anti-ovalbumin of the IgG1 isotype in mouse plasma and serum without prior sample purification. Affinity-purified anti-ovalbumin IgG1 isolated from the plasma of mice immunized with OVA/alum is used as the standard. The standard curve spans the range of 1.56-200 ng/ml, with an LLOQ of 1.56 ng/ml.  

     

    Brand:
    Cayman
    SKU:500830 - 96 wells

    Available on backorder

  • Brand:
    Cayman
    SKU:400834 - 200 ng

    Available on backorder

  • Brand:
    Cayman
    SKU:400934 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:489202 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:489202 - 5 ea

    Available on backorder

  • Histone H2AX, a variant of the nucleosome core histone H2A, undergoes phosphorylation on serine 139 in response to DNA damage, particularly when the damage involves formation of double-strand breaks. Phosphorylated H2AX is also termed γH2AX. Induction of γH2AX in cells exposed to genotoxic agents is considered a sensitive and specific reporter of DNA damage.{32236} This antibody reacts to γH2AX when phosphorylated at Ser139 and does not detect other phosphorylated histones.  

     

    Brand:
    Cayman
    SKU:20721 - 100 µg

    Available on backorder

  • Brand:
    Cayman
    SKU:709002 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:10004873 - 1 ea

    Available on backorder

  • The antioxidant system of living organisms includes enzymes such as superoxide dismutase, catalase, and glutathione peroxidase; macromolecules such as albumin, ceruloplasmin, and ferritin; and an array of small molecules, including ascorbic acid, α-tocopherol, β-carotene, reduced glutathione, uric acid, and bilirubin. The sum of endogenous and food-derived antioxidants represents the total antioxidant activity of the extracellular fluid. Cooperation of all the different antioxidants provides greater protection against attack by reactive oxygen or nitrogen radicals, than any single compound alone. Thus, the overall antioxidant capacity may give more relevant biological information compared to that obtained by the measurement of individual components, as it considers the cumulative effect of all antioxidants present in plasma and body fluids. The Cayman Chemical Antioxidant Assay Kit measures the total antioxidant capacity of plasma, serum, urine, saliva, or cell lysates. The assay relies on the ability of antioxidants in the sample to inhibit the oxidation of ABTS® (2,2′-azino-di-[3-ethylbenzthiazoline sulphonate]) to ABTS® · + by metmyoglobin.{8832,8913,8915,9407} The capacity of the antioxidants in the sample to prevent ABTS oxidation is compared with that of Trolox, a water-soluble tocopherol analogue, and is quantified as molar Trolox equivalents. Each kit contains assay buffer (10X), chromogen, metmyoglobin, trolox, hydrogen peroxide, a 96 well plate, plate cover, and complete instructions.  

     

    Brand:
    Cayman
    SKU:709001 - 96 wells

    Available on backorder

  • Brand:
    Cayman
    SKU:10004876 - 1 ea

    Available on backorder

  • Apoptosis is related to many diseases and is induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases. The mammalian homologues of the key cell death gene CED-4 in C. elegans has been identified recently from human and mouse and designated Apaf-1 (apoptosis protease-activating factor 1){6894,6873} Apaf-1 binds to cytochrome c (Apaf-2) and caspase-9 (Apaf-3), which leads to caspase-9 activation. Activated caspase-9 in turn cleaves and activates caspase-3, one of the key proteases responsible for the proteolytic cleavage of many key proteins in apoptosis.{6874} Apaf-1 can also associate with caspase-4 and caspase-8.{6878} Apaf-1 is ubiquitously expressed in human tissues.{6894}  

     

    Brand:
    Cayman
    SKU:160780 - 100 µg

    Available on backorder

  • ApoA1 is a major protein component in high-density lipoproteins (HDLs). It acts as an acceptor for sequential transfers of phospholipids and free cholesterol from peripheral tissues and transports cholesterol to the liver and other tissues for excretion and steroidogenesis.{14038} Serum ApoA1 levels are inversely related to the risk of developing atherosclerosis.{14039} Loss-of-function mutations are causes of diseases such as HDL deficiency type 1 (or Tangier disease) and type 2 (familial hypoalphalipoproteinemia), and systemic non-neuropathic amyloidosis.{14037,14040} Liver and small intestine are two main sources of the protein. ApoA1 is comprised of a single polypeptide chain of 243 amino acid residues with an estimated molecular weight of 28 kDa. Cayman’s ApoA1 Monoclonal Antibody detects the protein from diluted human plasma (≤10 µg total protein) by western blotting. Western blotting of recombinant ApoA1 samples suggest a detection limit of 5 ng.  

     

    Brand:
    Cayman
    SKU:13042 - 1 ea

    Available on backorder

  • ApoA1 is a major protein component in high-density lipoproteins (HDLs). It acts as an acceptor for sequential transfers of phospholipids and free cholesterol from peripheral tissues as well as transporting cholesterol to the liver and other tissues for excretion and steroidogenesis.{14038} Serum ApoA1 levels are inversely related to the risk of developing atherosclerosis.{14039} Loss-of-function mutations in ApoA1 are causes of diseases such as HDL deficiency type 1 (or Tangier disease) and type 2 (familial hypoalphalipoproteinemia), and systemic non-neuropathic amyloidosis.{14037,14040} Liver and small intestine are two main sources of the protein. Cayman’s ApoA1 Polyclonal Antibody detects the protein by WB analysis at 25 kDa in tissue/cell samples such as liver, intestine, and HepG2 cells.  

     

    Brand:
    Cayman
    SKU:10008463 - 500 μl

    Available on backorder

  • Amyloid precursor protein (APP) is a type I transmembrane protein that has a central role in the pathogenesis of Alzheimer’s disease, as well as additional roles in brain development, neuronal plasticity, and memory.{59228} APP is cleaved by β-secretase (BACE) in neuronal endosomes during amyloidogenic processing of APP, generating the C-terminal C99 fragment, which is localized to the endoplasmic membrane.{59223,59224} C99 is further cleaved by γ-secretase, liberating the APP intracellular domain (AICD) and generating amyloid-β (Aβ) peptides of various lengths, including Aβ40 (Item No. 21617) and Aβ42 (Item No. 20574), which are hallmarks of Alzheimer’s disease. APP can also be cleaved by α-secretase during non-amyloidogenic processing of APP, which occurs at the neuronal plasma membrane and generates the neuroprotective soluble APP fragment sAPPα, as well as a variety of other fragments, including the C47 fragment.{59228,59226} Transgenic mice expressing mutant forms of APP exhibit extracellular Aβ deposits in the brain, as well as cognitive dysfunction, and are widely used models of Alzheimer’s disease.{59227} Intraneuronal C99 levels are increased in the transgenic APPE693Q mouse model of Alzheimer’s disease, as well as postmortem frontal cortex from patients with sporadic Alzheimer’s disease.{59224,59225} Cayman’s APP (C99 Fragment) Monoclonal Antibody (Clone 8G4) can be used for ELISA and immunohistochemistry (IHC) applications. The antibody recognizes the C-terminal region corresponding to the C99 fragment to detect intact APP, as well as the C47 APP fragment.  

     

    Brand:
    Cayman
    SKU:28636 - 100 µg

    Available on backorder

  • ARAP2, also known as centaurin-d-1, is a protein with ARF-GAP, RHO-GAP, ankyrin repeat, RAS-associating, and pleckstrin homology domains. A phosphatidylinositol-3,4,5-trisphosphate (PtdIns-(3,4,5)-P3)-dependent GTPase-activating protein, ARAP2, binds to RhoA-GTP, but lacks the predicted catalytic arginine in the RHO-GAP domain and does not have RHO-GAP activity. It modulates actin cytoskeleton remodeling by regulating ARF and RHO family members. Usually ARAP2 is activated by PtdIns-(3,4,5)-P3 binding and can be activated by PtdIns-(3,4)-P2 binding, although with lower efficiency. ARAP2 associates with focal adhesions and functions downstream of RhoA to regulate focal adhesion dynamics. It is usually detected in brain, thymus, lymph node, thyroid, spinal cord, trachea, heart, skeletal muscle, spleen, kidney, liver, placenta, lung, and peripheral blood leukocytes.  

     

    Brand:
    Cayman
    SKU:13495 - 1 ea

    Available on backorder

  • Apoptosis is regulated by death domain (DD) and/or caspase recruitment domain (CARD) containing molecules and a caspase family of proteases. CARD domain-containing cell death regulators included RAIDD, Apaf-1, caspase-9, and caspase-2. A novel CARD domain containing protein was recently identified and designated ARC for apoptosis repressor with CARD.{7140} ARC interacts with caspase-2 and -8 and inhibits enzymatic activity of caspase-8. ARC suppresses apoptosis induced by cell death adapters FADD and TRADD and by cell death receptors Fas, TNFR-1 and DR3. The mRNA for ARC is expressed primarily in skeletal muscle and cardiac tissues.{7140}  

     

    Brand:
    Cayman
    SKU:160737 - 1 ea

    Available on backorder

  • AROS, a nucleolar protein with an unknown function, interacts with extraribosomal protein RPS19, playing a role in the signaling pathways that regulate rRNA transcription. The deduced amino acid sequence of AROS, derived from cDNA, defines an isoelectric point of 11.3. No known functional motifs were found in AROS except a short polylysine tract embedded in a putative nucleolar localization signal. At a basal level the protein is expressed ubiquitously with a significantly high level of expression in some tissues. Human AROS gene is mapped to chromosome 22q13.1.  

     

    Brand:
    Cayman
    SKU:13496 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:700422 - 25 ml

    Available on backorder

  • Ascorbate (L-Ascorbic acid or Vitamin C) is a six-carbon lactone that is synthesized from glucose in the liver of most mammalian species, but not by humans. Therefore, humans must obtain ascorbate in their diet in order to survive. In humans, ascorbate acts as an electron donor for eight different enzymes. It also serves as an antioxidant and may be beneficial for reducing the risk of developing chronic diseases such as cancer, cardiovascular disease, and cataracts. Cayman’s Ascorbate Assay provides a reproducible, sensitive fluorescence-based tool for quantifying ascorbate from plasma, serum, urine, and fruit juices.  

     

    Brand:
    Cayman
    SKU:700420 - 96 wells

    Available on backorder

  • Domoic acid (DA) and DA derivatives are water-soluble neurotoxins produced by a number of marine algae, in particular those of the genus Pseudo-nitzschia. Blooms of Pseudo-nitzschia may lead to the accumulation of DA in shellfish filter feeders and other marine species. Ingestion of DA-contaminated shellfish causes amnesic shellfish poisoning (ASP) and has been linked to the death of animal and human consumers in severe cases. The European Commission Directive 2002/226/EC has implemented a maximum permitted level (MPL) of 20 mg DA/kg shellfish flesh intended for human consumption, and this level has been adopted by regulatory authorities in most other countries. The ASP ELISA is specific for DA with no cross-reactivity to non-toxic, structural analogues like kainic acid, L-glutamic acid, L-glutamine, formimino-L-glutamic acid, proline or γ-aminobutyric acid (GABA). The assay is primarily intended for use in routine monitoring of DA levels in bivalve molluscs to comply with the regulatory MPL, but is also applicable for DA quantification in other marine matrices.  

     

    Brand:
    Cayman
    SKU:10008673 - 96 wells

    Available on backorder

  • Cayman’s Aspartate Aminotransferase Colorimetric Activity Assay Kit provides a convenient method of detecting AST activity in serum, plasma, tissue samples, and cell lysates. Measurement of the AST activity is carried out by monitoring the rate of NADH oxidation in a coupled reaction system employing malate dehydrogenase (MDH). The oxidation of NADH to NAD+ is accompanied by a decrease in absorbance at 340 nm. Under circumstances in which the AST activity rate is limiting, the rate of decrease is directly proportional to the AST activity in the sample. Lactate dehydrogenase (LDH) is added to prevent interference from endogenous pyruvate normally present in serum.  

     

    Brand:
    Cayman
    SKU:701640 - 96 wells

    Available on backorder

  • Asprosin is a glucogenic protein hormone secreted by white adipose tissue in mammals.{31498} This ~16 kDa protein is a 140 amino acid C-terminal cleavage product produced by furin cleavage of profibrillin. Asprosin increases glucose release via cyclic AMP (cAMP) and protein kinase A (PKA) in hepatocytes via interaction with a cell surface receptor, an effect that can be reversed by suramin, an inhibitor of heterotrimeric G proteins, or Rp-cAMPS (Item No. 16985), an antagonist of cAMP binding to PKA. In vivo, elevated plasma asprosin increases hepatic glucose production but does not affect glucose uptake in peripheral organs in response to insulin. Asprosin is orexigenic, activating AgRP+ neurons in a cAMP-dependent manner which leads to appetite stimulation and increased body weight.{37364} Plasma asprosin is elevated in adult humans and mice with type 2 diabetes mellitus and other genetic conditions that confer insulin resistance.{31498},{37365} Cayman’s Asprosin Polyclonal Antibody can be used for Western blot and immunoprecipitation.  

     

    Brand:
    Cayman
    SKU:23857 - 300 µg

    Available on backorder

  • Brand:
    Cayman
    SKU:760114 - 1 ea

    Available on backorder

  • The activating transcription factor 2 (ATF2; also called CRE-BP1) binds to both AP-1 and CRE DNA response elements and is a member of the ATF/CREB family of leucine zipper proteins.{14435} ATF2 has been implicated in the transcriptional regulation of a number of genes including cytokines, cell cycle control, and apoptosis. Various forms of cellular stress, including inflammatory cytokines and UV irradiation, stimulate the transcriptional activity of ATF2.{14433,14436} Stress induced ATF-dependent transcription is dependent on phosphorylation of ATF.{14432,14436} Serine 490 and serine 498 are novel phosphorylation sites on ATF that have recently been identified. ATF2 is particularly abundant in the brain and the ATF2 family of transcription factors is considered an important substrate of signals upstream of the activation of genes associated with neuronal growth and differentiation.{14339} ATF expression has also been linked to depression in humans.{14434}  

     

    Brand:
    Cayman
    SKU:10009410 - 100 µl

    Available on backorder

  • The activating transcription factors (ATFs) belong to the AP-1 family of transcription factors. ATF consists of seven members, ATF1 to 7. ATF7 (originally called ATFa) is ubiquitously expressed in various tissues and plays important roles in G1 and S phases. ATF7 might be important in controlling memory in cells of the innate immune system. [Bertin Catalog No. G01001]  

     

    Brand:
    Cayman
    SKU:32756 - 100 µl

    Available on backorder

  • Autophagy-related 4B (ATG4B), also known as autophagin-1, is a cysteine protease and a member of the C54 protease family with dual roles in the progression of autophagy.{42341,42342} It catalyzes the irreversible proteolytic cleavage of human homologs of yeast ATG8 belonging to the microtubule-associated protein 1 A/B-light chain 3 (MAP1LC3/LC3) and the GABA receptor-associated protein (GABARAP) subfamilies, including LC3, GATE16, GABARAP, and ATG8L, to expose a C-terminal glycine residue that is essential to formation of the autophagosome. It also catalyzes the reversible deconjugation of phosphatidylethanolamine from C-terminal glycine lipid-conjugated Atg8 homologs.{42343} ATG4B expression is increased in CD34+ chronic myeloid leukemia (CML) stem and progenitor cells and knockdown of ATG4B expression increases accumulation of LC3-II and p62, indicating impaired autophagy, and reduces the viability and inhibits proliferation of CD34+ CML cells.{42344} Atg4-/- mice exhibit systemic decreases in basal and induced autophagy as well as increased susceptibility to colitis induced by dextran sodium sulfate (DSS) and pulmonary fibrosis induced by bleomycin (Item No. 13877).{42345,42346} Cayman’s ATG4B Monoclonal Antibody (Clone 8A5) can be used for Western blot and ELISA applications. The antibody recognizes ATG4B at approximately 44 kDa from human samples.  

     

    Brand:
    Cayman
    SKU:25963 - 100 µg

    Available on backorder

  • Autophagy-related 5 (ATG5), formerly known as apoptosis-specific protein (ASP), is a protein that is essential to autophagosome elongation.{47096,47097,47098} ATG5 is covalently conjugated to the C-terminal glycine residue of ATG12 (ATG12-ATG5) and forms a non-covalent complex with ATG16 (ATG12-ATG5-ATG16), which functions as an E3 ubiquitin ligase-like enzyme to facilitate LC3 transfer from ATG3 to phosphatidylethanolamine in canonical autophagy. ATG12-ATG5 also binds to the ATG12-ATG5-interaction region of the lysosomally localized protein TECPR1, freeing the TECPR1 pleckstrin homology domain to interact with phosphatidylinositol 3-phosphate components in the autophagosome membrane, promoting autophagosome-lysosome fusion.{47098} Polymorphisms in ATG5 have been associated with various autoimmune diseases, including lupus nephritis and Behçet’s disease, gastrointestinal and colorectal cancers, as well as sporadic Parkinson’s disease and childhood asthma. Cayman’s ATG5 Monoclonal Antibody (Clone 1F8) can be used for ELISA and immunofluorescence applications.  

     

    Brand:
    Cayman
    SKU:28812 - 100 µg

    Available on backorder

  • Autophagy-related 5 (ATG5), formerly known as apoptosis-specific protein (ASP), is a protein that is essential to autophagosome elongation.{47096,47097,47098} ATG5 is covalently conjugated to the C-terminal glycine residue of ATG12 (ATG12-ATG5) and forms a non-covalent complex with ATG16 (ATG12-ATG5-ATG16), which functions as an E3 ubiquitin ligase-like enzyme to facilitate LC3 transfer from ATG3 to phosphatidylethanolamine in canonical autophagy. ATG12-ATG5 also binds to the ATG12-ATG5-interaction region of the lysosomally localized protein TECPR1, freeing the TECPR1 pleckstrin homology domain to interact with phosphatidylinositol 3-phosphate components in the autophagosome membrane, promoting autophagosome-lysosome fusion.{47098} Polymorphisms in ATG5 have been associated with various autoimmune diseases, including lupus nephritis and Behçet’s disease, gastrointestinal and colorectal cancers, as well as sporadic Parkinson’s disease and childhood asthma. Cayman’s ATG5 Monoclonal Antibody (Clone 4D5) can be used for ELISA, immunohistochemistry, and Western blot applications. The antibody recognizes the ATG5-ATG12 complex at approximately 56 kDa from human samples.  

     

    Brand:
    Cayman
    SKU:26671 - 100 µg

    Available on backorder

  • Cayman’s ATP Detection Assay Kit – Luminescence provides a simple and effective tool for measuring total ATP levels. This assay uses firefly luciferase to convert ATP and luciferin to oxyluciferin and light. The light emitted in this reaction is directly proportional to the concentration of ATP present. Using the ATP Detection Standard, quantitative measurement of ATP content can be achieved with a dynamic range of 12 fmol to 10 pmol of ATP.  

     

    Brand:
    Cayman
    SKU:700410 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:700582 - 60 µl

    Available on backorder

  • Brand:
    Cayman
    SKU:700581 - 5 ml

    Available on backorder

  • Autotaxin (ATX, Ectonucleotide Pyrophosphatase/Phosphodiesterase-2, ENPP-2, Lysophospholipase D) is a secreted lysophospholipase D that catalyzes the hydrolysis of lysophosphatidylcholine (LPC) to generate lysophosphatidic acid (LPA). LPA is a lipid mediator that activates G protein-coupled receptors and induces a variety of biological responses, such as neurogenesis, angiogenesis, smooth-muscle contraction, platelet aggregation, and wound healing. ATX-LPA signaling is involved in a range of pathologies including tumor progression and inflammation. Cayman’s Autotaxin Inhibitor Screening Assay provides a convenient method for screening human ATX inhibitors. ATX cleaves bis-(p-nitrophenyl) phosphate liberating p-nitrophenol, a yellow product that is measured at 405-415 nm.  

     

    Brand:
    Cayman
    SKU:700580 - 96 wells

    Available on backorder

  • Rapidly accelerated fibrosarcoma (Raf) kinase is a serine/threonine kinase and component of the MAPK/ERK signaling pathway.{54387,54388} Upon activation by upstream RAS signaling, Raf dimerizes and phosphorylates MEK1 leading to activation of transcription factors for cell growth, proliferation, and survival.{54388} Raf exists as three isoforms, A-RAF, B-RAF, and C-RAF, that all consist of three conserved regions (CRs) with domain-specific functions.{54387} CR1 contains a cysteine-rich domain and a RAS-binding domain, CR2 is essential for negative regulation through inhibition of phosphorylation sites, and CR3 is the kinase domain. B-RAF is the most prominent isoform, expressed in most tissues, and localized to the cytosol. A single amino acid substitution of glutamic acid for valine at codon 600 in the kinase domain (B-RAFV600E) is an activating mutation that is found in melanoma and non-small cell lung cancer (NSCLC), as well as breast, thyroid, colorectal, and ovarian cancers.{54387,54388} B-RAFV600E is associated with early-stage ovarian cancer, as well as with increased risk of brain metastasis and shorter survival in melanoma.{54387,54389} Cayman’s B-RAFV600E Monoclonal Antibody can be used for ELISA, immunocytochemistry (ICC), immunohistochemistry (IHC), and Western blot (WB) applications.  

     

    Brand:
    Cayman
    SKU:32188 - 100 µg

    Available on backorder

  • Beclin 1 (BECN1) is a core component of the class III phosphatidylinositol 3-kinase (PI3K) complex, which generates phosphatidylinositol 3-phosphate (PI3P) and has functions in macroautophagy and the endocytic pathway when associated with ATG14 and UVRAG, respectively.{43560} BECN1 is comprised of a BH3 domain involved in Bcl-2/Bcl-xL binding, a coiled-coil domain, and an evolutionarily conserved domain (ECD) that is required for association with the PI3K complex.{43562,43563} Binding of BECN1 to various BECN1-interacting proteins can regulate the activity of the ATG14-containing PI3K complex, which is required for nucleation of the phagophore during macroautophagy.{43560,43561} Binding of the anti-apoptotic protein Bcl-2 to BECN1 prevents the association of BECN1 with the PI3K complex and inhibits autophagy, whereas AMBRA1, which also binds directly to BECN1, positively regulates the PI3K complex to facilitate autophagy.{43560,43563} Transfection of autophagy-deficient MCF-7 human breast cancer cells with wild-type BECN1, but not a BECN1 mutant lacking the ECD, increases starvation-induced autophagy in vitro and inhibits tumor growth in an MCF-7 mouse xenograft model, indicating that BECN1 has ECD-dependent tumor suppressor activity.{43562} BECN1 heterozygous mice expressing human amyloid precursor protein (APP+Becn1+/- mice) have decreased autophagy in the cerebral cortex, increased extracellular amyloid-β (Aβ) deposits in the frontal cortex, and increased intraneuronal Aβ accumulation in the hippocampus and frontoparietal cortex compared to APP+Becn1+/- mice.{43564} BECN1 may also have roles in ischemia/reperfusion injury, Niemann-Pick type C disease, and protection against viral infection.{43563} Cayman’s Beclin 1 Monoclonal Antibody (Clone 5F7) can be used for Western blot and ELISA applications. The antibody recognizes Beclin 1 at approximately 52 kDa from human samples.  

     

    Brand:
    Cayman
    SKU:25964 - 100 µg

    Available on backorder

  • Cayman’s Benzodiazepine ELISA Kit is a competitive assay that can be used for quantification of benzodiazepines in plasma, serum, and urine. The assay has a range of 0.041-25 ng/ml with a midpoint of approximately 1.3 ng/ml (50% B/B0) and a sensitivity (80% B/B0) of approximately 0.3 ng/ml.  

     

    Brand:
    Cayman
    SKU:501800 - 96 solid well

    Available on backorder

  • Cayman’s Benzodiazepine ELISA Kit is a competitive assay that can be used for quantification of benzodiazepines in plasma, serum, and urine. The assay has a range of 0.041-25 ng/ml with a midpoint of approximately 1.3 ng/ml (50% B/B0) and a sensitivity (80% B/B0) of approximately 0.3 ng/ml.  

     

    Brand:
    Cayman
    SKU:501800 - 96 strip well

    Available on backorder

  • Benzodiazepine ELISA Standard has been tested and formulated to work exclusively with Cayman’s Benzodiazepine ELISA Kit (Item No. 501800). Please visit Benzodiazepine ELISA Kit (Item No. 501800) for the kit protocol, procedures, and product handling.  

     

    Brand:
    Cayman
    SKU:401804 - 1.25 µg

    Available on backorder

  • Cayman’s reverse transfection reporter assays have overcome many of the disadvantages of other transfection approaches. In this method, a proprietary transfection complex containing DNA and an optimized mixture of lipids and proteins has been evenly immobilized on the culture surface of multi-well plates. Adherent cells, supplied by the user, are applied directly to the plate and allowed to grow in the coated wells. Using this method, the uptake of the DNA complex by the cell is increased dramatically compared to solution-phase transfection, enhancing both the transfection efficiency and co-transfection efficiency for multiple plasmids. Cayman’s Bile Acid Nuclear Receptor FXR (NR1H4) Reporter Assay Kit consists of a 96-well plate coated with a transfection complex containing DNA constructs for expressing FXR and a BSEP promoter-regulated secreted alkaline phosphatase (SEAP) reporter (FXR Reverse Transfection Strip Plate). Cells grown on the transfection complex will express FXRα2 inside the cells within 24 hours from an engineered plasmid construct. Binding of agonists to FXR triggers its transcription factor activity. Activation of the BSEP promoter on the reporter construct by FXR results in the expression of SEAP, which is secreted into the cell culture medium. Aliquots of media are collected 6-24 hours after stimulation, and SEAP activity is measured following addition of a luminescence-based alkaline phosphatase substrate (SEAP Substrate (Luminescence)). The kit is easy to use and can be readily applied to high-throughput screening for therapeutic compounds regulating the activation of FXR. A selective synthetic agonist, XL335, is included in the kit for use as a positive control.{37177} The kit provides sufficient reagent to measure SEAP activity at three time points using the three included assay plates.  

     

    Brand:
    Cayman
    SKU:601790 - 1 ea

    Available on backorder

  • Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bim/BOD is a group of three splice variants, BimEL, BimL and BimS, with apparent molecular masses of ~23, 16, and 13 kDa, respectively. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3 domain containing pro-apoptotic proteins, including Bad, Bax, Bid, Bik, and Hrk, form a growing subclass of the Bcl-2 family. A novel BH3 domain containing protein was recently identified and designated Bim or BOD in human, mouse, and rat.{7144,7141} Bim/BOD interacts with diverse members in the pro-survival Bcl-2 sub-family including Bcl-2, Bcl-xL and Bcl-w. Bim/BOD induces apoptosis. The messenger RNA of Bim is ubiquitously expressed in multiple tissues and cell lines.{7144,7141}  

     

    Brand:
    Cayman
    SKU:10011385 - 100 µg

    Available on backorder

  • Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bim/BOD is a group of three splice variants, BimEL, BimL and BimS, with apparent molecular masses of ~23, 16, and 13 kDa, respectively. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3 domain containing pro-apoptotic proteins, including Bad, Bax, Bid, Bik, and Hrk, form a growing subclass of the Bcl-2 family. A novel BH3 domain containing protein was recently identified and designated Bim or BOD in human, mouse, and rat.{7144,7141} Bim/BOD interacts with diverse members in the pro-survival Bcl-2 sub-family including Bcl-2, Bcl-xL and Bcl-w. Bim/BOD induces apoptosis. The messenger RNA of Bim is ubiquitously expressed in multiple tissues and cell lines.{7144,7141}  

     

    Brand:
    Cayman
    SKU:10011385 - 25 µg

    Available on backorder

  • Biotinidase is a peptidyl hydrolase that cleaves biocytin and biotinylated peptides in vivo to generate free biotin, an essential coenzyme for certain carboxylases involved in fatty acid, amino acid, and glucose metabolism.{32218,42936} Early-onset biotinidase deficiency is due to deletion, insertion, substitution, or missense mutations in the biotinidase gene, BTD, that affect the activity of multiple carboxylases. This profound biotinidase deficiency results in seizures, ataxia, sensorineural hearing loss or vision loss, eczema, and respiratory disruptions without treatment. Partial biotinidase deficiency is due to a substitution mutation in the BTD gene resulting in a 70-90% reduction in biotinidase activity leading to symptom manifestation that may not occur until adolescence and occurs only under biological stress. Many symptoms resolve with treatment, but retinal degeneration, sensorineural hearing loss, and developmental delays cannot be reversed. Early detection of biotinidase deficiency is imperative to avoid permanent damage.  

     

    Brand:
    Cayman
    SKU:27544 - 1 ea

    Available on backorder

  • The human BLT1 receptor is a G protein-coupled receptor that mediates the proinflammatory effects of leukotriene B4 (LTB4).{4425} Northern blotting reveals that the BLT1 receptor is highly expressed in leukocytes, U937 cells, and to a much lower extent in spleen and thymus.{4425} Sheep lung membranes have also been identified as a rich source for receptor isolation and purification.{4640} A second, low-affinity LTB4 receptor, BLT2, has also been cloned and characterized.{8280,8525,8743} Cayman Chemical’s BLT1 Receptor Monoclonal Antibody is a useful tool for the detection of human BLT1 by flow cytometry, immunofluorescence, and immunohistochemistry. The antibody does not cross react with the other leukotriene receptors (BLT2, CysLT1, or CysLT2) and does not work for Western blot analysis of BLT1.  

     

    Brand:
    Cayman
    SKU:120111 - 1 ea

    Available on backorder

  • The leukotriene B4 receptor 1 (BLT1 receptor), cloned from HL-60 human leukemia cells, has 352 amino acids and seven putative membrane-spanning domains.{4425} The primary structure of the receptor is identical to that of a putative purinoceptor, P2Y7, which binds to micromolar concentrations of ATP.{4424} Northern blotting reveals that the BLT1 receptor is highly expressed in leukocytes, U937 cells, and to a much lower extent in spleen and thymus.{4425} Sheep lung membranes have also been identified as a rich source for receptor isolation and purification.{4640} A second LTB4 receptor, BLT2, has recently been cloned and characterized.{8280,8525,8743} This antibody was made against a peptide from the C-terminus of the BLT1 receptor, which is located on the intracellular side of the plasma membrane. Therefore, when performing studies on whole cells, permeabilization of the cells is required for the antibody to enter the cytosol.  

     

    Brand:
    Cayman
    SKU:120114 - 500 µl

    Available on backorder

  • Leukotriene B4 (LTB4) promotes a number of leukocyte functions including aggregation, stimulation of ion fluxes, superoxide anion production, chemotaxis, and chemokinesis. Two G-protein coupled receptors, BLT1 and BLT2, which mediate the actions of LTB4 have been cloned and characterized.{8280,8743,8525,4425} The BLT1 receptor is expressed in leukocytes, U937 cells, and to a much lower extent in spleen and thymus.{4425} The human BLT2 receptor is a 358 amino acid protein with approximately 40% homology to BLT1 at the amino acid level.{8280,8743,8525} The BLT2 receptor is more broadly expressed than the BLT1 receptor, with highest levels observed in liver, spleen, ovary, intestine, and peripheral blood leukocytes.{8280,8743,8525} Activation of the BLT2 receptor by LTB4 leads to Ca2+ mobilization as well as decreases in cyclic AMP, indicating interaction of the receptor with Gq and Gi classes of G-proteins.{8743}  

     

    Brand:
    Cayman
    SKU:120124 - 1 ea

    Available on backorder

  • Bnc 1 is a 994 amino acid transcription factor specific for squamous epithelium and for the constituent keratinocytes at a stage either prior to or at the very beginning of terminal differentiation. It is a zinc finger protein with three separated pairs of zinc fingers and a nuclear localization signal. Bnc 1 is a soluble protein that can shuttle between the nucleus and the cytoplasm, and its location depends on the proliferative potential of the cell. It is expressed relatively uniformly in the nucleoplasm, and phosphorylation on Ser537 and Ser541 leads to its cytoplasmic localization. It is present in the basal cell layer of the epidermis, in hair follicles and also in abundance in the germ cells of testis and ovary, and to a lower extent in thymus, spleen, mammary glands, placenta, brain, and heart. Reports suggest that it plays a regulatory role in keratinocyte proliferation and also in rRNA transcription. It is also known to play a role in the differentiation of spermatozoa and oocytes.  

     

    Brand:
    Cayman
    SKU:13502 - 1 ea

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine Activin A. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0301-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine BDNF. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0307-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine BMP-2. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0311-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine BMP-4. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0314-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine BMP-5. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0310-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine CXCL14. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK1285-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine Endothelin. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0945-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine FGF9. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0348-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine GDF5. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK1504-BV

    Available on backorder

  • Brand:
    Cayman
    SKU:700019 - 100 µl

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine IGF-1. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0376-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine Neurotrophin-3. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0472-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of activated Bovine TGF beta 1. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0513-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of activated Bovine TGF-beta 2. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK0981-BV

    Available on backorder

  • Sandwich High Sensitivity ELISA kit for Quantitative Detection of activated Bovine TGF-beta 3. 96wells/kit, with removable strips.   

     

    Brand:
    Boster Bio
    SKU:EK1103-BV

    Available on backorder

  • c-Fos is a widely expressed nuclear protein and member of the Fos protein family that includes c-Fos, FosB, Fra-1, and Fra-2.{55194} It is a proto-oncogene that contains a leucine zipper motif to facilitate heterodimerization with Jun family proteins, such as c-Jun, to form the transcription factor complex activator protein-1 (AP-1) that has roles in cell proliferation, differentiation, and apoptosis. Expression of c-fos is induced in response to growth factors, tumor promoters, cytokines, and UV radiation.{55194,55195} In neurons, c-fos expression is induced upon depolarization and is widely used as a marker of neuronal activation.{55196} c-fos is also overexpressed in a variety of tumor cells, and transgenic overexpression of c-fos in mice induces formation of chondrosarcomas.{55195,55197} Cayman’s c-Fos Monoclonal Antibody can be used for immunocytochemistry (ICC), immunohistochemistry (IHC), and Western blot (WB) applications. The antibody recognizes c-Fos at approximately 50 kDa from human, bovine, mouse, and rat samples.  

     

    Brand:
    Cayman
    SKU:29262 - 100 µl

    Available on backorder

  • C-Reactive Protein (CRP) is a 224 amino acid protein that is synthesized primarily by hepatocytes, and to a lesser extent adipocytes. CRP plasma levels increase ~1,000-fold in response to acute and chronic inflammatory conditions, making it a useful gauge of inflammation in a wide range of physiological and pathological conditions.{15269} Normal levels of serum CRP (0.64 µg/ml) do not differ between healthy adult men and women, but tend to increase slightly with age.{15308} High plasma CRP concentrations (>3 µg/ml) are associated with an increased risk for atherosclerosis.{15307} CRP has been implicated as a contributor to atherogenesis by modulating endothelial function, stimulating coagulation, inducing the expression of ICAM-1, VCAM-1, and E-selectin, mediating uptake of LDL into macrophages, and destabilizing plaques.{15269,15777,15778,15779,10506,15280,15270} In addition, CRP can bind in a calcium-dependent manner to phosphocholine on microbes, act as a ligand for specific receptors on phagocytic leukocytes, mediate activation of monocytes and macrophages via IL-6, TNF-α and other cytokines, and assist in the complement pathway.{15269,15774,15775,15773} Cayman’s CRP (human) ELISA Kit is an immunometric assay which can be used to measure CRP in plasma without prior sample purification. The standard curve spans the range of 46.9-3,000 pg/ml with a limit of detection of approximately 46.9 pg/ml.  

     

    Brand:
    Cayman
    SKU:10011236 - 96 wells

    Available on backorder

  • Cayman’s Calcium Assay provides a quick, reliable method for determining total calcium concentration in a variety of biological samples, as well as tissue homogenates and cell lysates. The assay utilizes an optimized variant of the well-established o-Cresolphthalein-calcium reaction in which a vivid purple complex that absorbs between 560 and 590 nm is formed in the presence of calcium.  

     

    Brand:
    Cayman
    SKU:701220 - 2 x 96 wells

    Available on backorder

  • Calponin-1 is an actin binding protein and a component of smooth muscle cell (SMC) contractile machinery that is encoded by CNN1 in humans.{54434,54435} It is a thin filament-associated protein expressed exclusively in SMCs that interacts with actin to inhibit the movement of actin and myosin, as well as the actin-activated MgATPase activity of phosphorylated myosin.{54436} High levels and low levels of calponin-1 are associated with low and high disease progression risk, respectively, in patients with ductal carcinoma in situ (DCIS).{54437} Downregulation of arterial Cnn1 expression promotes proliferation of vascular SMCs (VSMCs) in a DOCA-salt rat model of hypertension and a pig model of hypertension induced by aortic coarctation.{54435} Cayman’s Calponin-1 (C-Term) Rabbit Monoclonal Antibody can be used for immunocytochemistry (ICC) and Western blot (WB) applications.  

     

    Brand:
    Cayman
    SKU:32207 - 100 µl

    Available on backorder

  • Calretinin is a calcium-binding protein and member of the large EF-hand protein family that is encoded by CALB2 in humans.{59515} It is composed of six EF-hand domains, each of which contains two α-helices oriented perpendicular to each other around a calcium-binding domain. Calretinin is expressed in specific neuronal populations, including granule cells of the cerebellum, auditory neurons, and retinal neurons, and is localized to the cytosol where it has a role in the modulation of neuronal excitability. It is also expressed under pathological conditions, particularly in epithelial mesothelioma cells and colon adenocarcinomas. Calb2-/- mice exhibit impaired induction of long-term potentiation following tetanic hippocampal stimulation. Levels of calretinin are increased in the dorsomedial and ventromedial hypothalamic nuclei in aged rats.{59516} Cayman’s Calretinin (N-Term) Rabbit Monoclonal Antibody can be used for immunohistochemistry (IHC) and Western blot (WB) applications.  

     

    Brand:
    Cayman
    SKU:32262 - 100 µl

    Available on backorder

  • Calcium/calmodulin-dependent protein kinase II (CaMKII) is a serine/threonine protein kinase and member of the calcium/calmodulin-activated protein kinase family.{53680,15705,15706} There are four isoforms of CaMKII, α, β, γ, and δ, encoded by CaMK2A, CaMK2B, CaMK2G, and CaMK2D in humans.{53680} CaMKIIα and CaMKIIβ are predominantly expressed in neuronal tissue, while CaMKIIγ and CaMKIIδ are primarily found in cardiac tissue, however, the various isoforms of CaMKII can be found in nearly all cell types. Upon calcium binding, CaMKII undergoes a conformational switch that displaces the autoinhibitory domain inducing autophosphorylation of threonine 286 (Thr286) and autonomous activation of the kinase.{15712} Activation of CaMKII in dendritic spines in response to increased calcium concentration facilitates the induction of long term potentiation (LTP) and memory formation in rodents.{53681} Phospho-site mutant Camk2aT286A knock-in mice exhibit impaired LTP, as well as learning and memory deficits.{53681} Cayman’s CaMKII (Phospho-Thr286) Polyclonal Antibody can be used for immunohistochemistry (IHC) and Western blot (WB) applications. The antibody recognizes CaMKIIα phospho-Thr286 and CaMKIIβ phospho-Thr286 at approximately 50 and 60 kDa, respectively, from human, mouse, rabbit, and rat samples.  

     

    Brand:
    Cayman
    SKU:29253 - 100 µl

    Available on backorder

  • CaMKII is an important member of the calcium/calmodulin-activated protein kinase family, functioning in neural synaptic stimulation and T-cell receptor signaling.{15705,15706} CaMKII is expressed in many different tissues but is specifically found in the neurons of the forebrain and its mRNA is found within the dendrites and the soma of the neuron. The CaMKII that is found in the neurons consists of two subunits of 52 (termed α genes) and 60 kDa (β genes). CaMKII has catalytic and regulatory domains, as well as an ATP-binding domain, and a consensus phosphorylation site.{15707,15708,15709,15710,15711} The binding of Ca2+/calmodulin to its regulatory domain releases its auto inhibitory effect and activates the kinase.{15712} This kinase activation results in autophosphorylation at threonine 286 (Thr286).{15712} The threonine phosphorylation state of CaMKII can be regulated through protein phosphatase 1 (PP1)/protein kinase A (PKA). Whereas PP1 dephosphorylates phospho-CaMKII at Thr286, PKA prevents this dephosphorylation.{15713} Autophosphorylation also enables CaMKII to attain an enhanced affinity for NMDA receptors in postsynaptic densities.{15714,15715,15716}  

     

    Brand:
    Cayman
    SKU:10011438 - 100 µg

    Available on backorder

  • CaMKII is an important member of the calcium/calmodulin-activated protein kinase family, functioning in neural synaptic stimulation and T-cell receptor signaling.{15705,15706} CaMKII is expressed in many different tissues but is specifically found in the neurons of the forebrain and its mRNA is found within the dendrites and the soma of the neuron. The CaMKII that is found in the neurons consists of two subunits of 52 (termed α genes) and 60 kDa (β genes). CaMKII has catalytic and regulatory domains, as well as an ATP-binding domain, and a consensus phosphorylation site.{15707,15708,15709,15710,15711} The binding of Ca2+/calmodulin to its regulatory domain releases its auto inhibitory effect and activates the kinase.{15712} This kinase activation results in autophosphorylation at threonine 286 (Thr286).{15712} The threonine phosphorylation state of CaMKII can be regulated through protein phosphatase 1 (PP1)/protein kinase A (PKA). Whereas PP1 dephosphorylates phospho-CaMKII at Thr286, PKA prevents this dephosphorylation.{15713} Autophosphorylation also enables CaMKII to attain an enhanced affinity for NMDA receptors in postsynaptic densities.{15714,15715,15716}  

     

    Brand:
    Cayman
    SKU:10011438 - 25 µg

    Available on backorder

  • CaMKII is an important member of the calcium/calmodulin-activated protein kinase family, functioning in neural synaptic stimulation and T-cell receptor signaling.{15705,15706} CaMKII is expressed in many different tissues but is specifically found in neurons of the forebrain and its mRNA is found within the dendrites and the soma of the neuron. The CaMKII that is found in the neurons consist of two subunits of 52 (termed α genes) and 60 kDa (β genes). CaMKII has catalytic and regulatory domains, as well as an ATP-binding domain, and a consensus phosphorylation site.{15707,15708,15709,15710,15711} The binding of Ca2+/calmodulin to its regulatory domain releases its auto inhibitory effect and activates the kinase.{15712} This kinase activation results in autophosphorylation at threonine 286 (Thr286).{15712} The threonine phosphorylation state of CaMKII can be regulated through protein phosphatase 1 (PP1)/protein kinase A (PKA). Whereas PP1 dephosphorylates phospho-CaMKII at Thr286, PKA prevents this dephosphorylation.{15713} Autophosphorylation also enables CaMKII to attain an enhanced affinity for NMDA receptors in postsynaptic densities.{15714,15715,15716}  

     

    Brand:
    Cayman
    SKU:10011437 - 100 µg

    Available on backorder

  • CaMKII is an important member of the calcium/calmodulin-activated protein kinase family, functioning in neural synaptic stimulation and T-cell receptor signaling.{15705,15706} CaMKII is expressed in many different tissues but is specifically found in neurons of the forebrain and its mRNA is found within the dendrites and the soma of the neuron. The CaMKII that is found in the neurons consist of two subunits of 52 (termed α genes) and 60 kDa (β genes). CaMKII has catalytic and regulatory domains, as well as an ATP-binding domain, and a consensus phosphorylation site.{15707,15708,15709,15710,15711} The binding of Ca2+/calmodulin to its regulatory domain releases its auto inhibitory effect and activates the kinase.{15712} This kinase activation results in autophosphorylation at threonine 286 (Thr286).{15712} The threonine phosphorylation state of CaMKII can be regulated through protein phosphatase 1 (PP1)/protein kinase A (PKA). Whereas PP1 dephosphorylates phospho-CaMKII at Thr286, PKA prevents this dephosphorylation.{15713} Autophosphorylation also enables CaMKII to attain an enhanced affinity for NMDA receptors in postsynaptic densities.{15714,15715,15716}  

     

    Brand:
    Cayman
    SKU:10011437 - 25 µg

    Available on backorder

  • Alpha-1 antitrypsin is a serine protease inhibitor and member of the serpin superfamily.{36461} It has a five-stranded A β-sheet and a mobile reactive center loop that acts as a pseudosubstrate for various proteases. Alpha-1 antitrypsin binds to a protease, undergoes proteolytic cleavage, and forms a covalent linkage between a carboxyl group in the reactive loop and the serine hydroxyl of the protease active site, effectively inactivating the enzyme which is then cleared from circulation. The primary targets of alpha-1 antitrypsin are neutrophil elastase and proteinase 3, however, it also inhibits trypsin, kallikreins 7 and 14, and matriptase.{36460} Alpha-1 antitrypsin protects the lower respiratory tract from proteolytic destruction via inhibition of neutrophil elastase and reduced serum levels of alpha-1 antitrypsin have been linked to early-onset liver disease and emphysema.{36459} Alpha-1 antitrypsin is an acute-phase protein that reduces production of inflammatory cytokines, inhibits apoptosis, blocks leukocyte degranulation and migration, as well as suppresses NF-κB nuclear translocation in monocytes. It delays disease onset in mouse models of inflammatory disease, including collagen-induced arthritis and experimental autoimmune encephalomyelitis (EAE). Alpha-1 antitrypsin is subject to post-translational modifications such as glycosylation and carbamylation in vivo. Carbamylated alpha-1 antitrypsin has been found in synovial fluid samples from rheumatoid arthritis patients and is predicted to act as an autoantigen.{36462} Cayman’s Carbamylated Alpha-1 Antitrypsin (K359) Polyclonal Antibody can be used for Western blot applications. This antibody recognizes carbamylated alpha-1 antitrypsin at ~47 kDa from human samples.  

     

    Brand:
    Cayman
    SKU:25340 - 500 µl

    Available on backorder

  • Cardiac troponin I (cTnI) is a subunit of the troponin complex in cardiac muscle thin filaments, which plays a role in muscle activity.{55210} It is encoded by TNNI3 in humans and is expressed exclusively in the heart. cTnI is a multidomain protein composed of an N-terminal domain, IT-arm, inhibitory domain, regulatory domain, and C-terminal mobile domain. The N-terminal domain is exclusive to cTnI and is essential to the interaction of cTnI with troponin C and in the regulation of calcium-dependent muscle contraction. cTnI binds to actin to hold the troponin complex in place in thin myofilaments. Phosphorylation of cTnI at serines 22 and 23 in the N-terminus decreases sarcomere calcium sensitivity, promotes calcium dissociation from troponin C, and enhances diastolic relaxation.{55219,55221} Cardiac systolic dysfunction in human and animal models of heart failure is linked to PKC phosphorylation of cTnI at serines 23, 24, 43, and 45, as well as threonine 144.{55221} Cayman’s Cardiac Troponin I Polyclonal Antibody can be used for Western blot (WB) applications. The antibody recognizes cTnI at approximately 25 kDa from human, mouse, and rat samples.  

     

    Brand:
    Cayman
    SKU:29298 - 100 µl

    Available on backorder

  • Caspase-1 Assay Buffer (5X) has been formulated and tested to work with Cayman’s Assay Kits. Detailed instructions for its use are contained in the respective Cayman Assay Kit booklet.  

     

    Brand:
    Cayman
    SKU:701841 - 5 ml

    Available on backorder

  • Cayman’s Caspase-1 Inhibitor Screening Assay Kit provides a robust and easy-to-use platform for identifying novel inhibitors of human caspase-1, the major downstream effector following inflammasome activation. The assay uses a caspase-1-specific fluorogenic substrate, Ac-YVAD-AFC. Caspase-1 cleaves this substrate generating free AFC, which can be easily quantified using a fluorescence plate reader at excitation and emission wavelengths of 400 and 505 nm, respectively. The potent and reversible caspase-1 inhibitor Ac-YVAD-CHO is included as a positive control.  

     

    Brand:
    Cayman
    SKU:701840 - 384 wells

    Available on backorder

  • Caspases are a family of cysteine proteases that are key mediators of programmed cell death or apoptosis.{1642} The precursor form of all caspases is composed of a prodomain and large and small catalytic subunits. The active forms of caspases are generated by several stimuli including ligand-receptor interactions, growth factor deprivation and inhibitors of cellular functions. All known caspases require cleavage adjacent to aspartates to liberate one large and one small subunit, which associate into a tetramer to form the active enzyme. Caspase-1 is similar to the cell death gene CED-3 of C. elegans and regulates multiple proinflammatory cytokines, including interleukin-1β and interferon-γ-inducing factor.  

     

    Brand:
    Cayman
    SKU:13907 - 1 ea

    Available on backorder

  • Caspases are a family of cysteine proteases that are key mediators of programmed cell death or apoptosis.{18384} The precursor form of all caspases is composed of a prodomain and large and small catalytic subunits. The active forms of caspases are generated by several stimuli including ligand-receptor interactions, growth factor deprivation, and inhibitors of cellular functions. All known caspases require cleavage adjacent to aspartates to liberate one large and one small subunit, which associate into an a2b2 tetramer to form the active enzyme. Caspase-14 has a conserved active site pentapeptide, QACRG. However, no proteolytic or biological activities have been identified so far. Its high expression in embryonic tissues and limited expression in adult tissues suggests that it may have some role during ontogenesis.  

     

    Brand:
    Cayman
    SKU:13916 - 1 ea

    Available on backorder

  • Apoptosis is associated with many diseases and is induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases. Caspase-3 is a key effector caspase in the apoptosis cascade.{7216,6292} The enzyme is efficiently activated by caspase-8, caspase-9, and granzyme B resulting in 17 and 12 kDa active subunits formed from the 34 kDa proenzyme.{7216, 8444} The substrates of caspase-3 are numerous and include pro- and anti-apoptotic proteins, downstream components of the apoptotic machinery (for example, ICAD), as well as structural and homeostatic proteins.{7216,6292} DNA fragmentation and the morphological changes associated with this final stage of apoptosis appears to be dependent upon caspase-3.{6291} Caspase-3 is expressed in a variety of tissues and cells.{8444,8443}  

     

    Brand:
    Cayman
    SKU:160745 - 1 ea

    Available on backorder

  • Caspases are a family of cysteine proteases that are key mediators of programmed cell death or apoptosis.{18384} The precursor form of all caspases is composed of a prodomain and large and small catalytic subunits. The active forms of caspases are generated by several stimuli including ligand-receptor interactions, growth factor deprivation, and inhibitors of cellular functions. All known caspases require cleavage adjacent to aspartates to liberate one large and one small subunit, which associate into a tetramer to form the active enzyme. The gene for caspase-3 also known as Yama, CPP32, and apopain codes for a 32 kDa protein.{8444,18385,18386} Caspase-3 cleaves the death substrate poly(ADP-ribose) polymerase (PARP) to a specific 85 kDa form observed during apoptosis and is inhibitable by the CrmA protein. Other caspase-3 substrates include DNA-PK, actin, GAS2, and pro-caspase-6.{6292} Caspase-3 is activated by cleavage events at Asp28/Ser29 (between N-terminal pro-domain) and Asp175/Ser176 (between large and small subunits) to generate a large subunit of 17 kDa and a small subunit of 12 kDa.{18385}  

     

    Brand:
    Cayman
    SKU:13909 - 1 ea

    Available on backorder

  • Caspases are a family of cysteine proteases that are key mediators of programmed cell death or apoptosis.{18384} The precursor form of all caspases is composed of a prodomain and large and small catalytic subunits. The active forms of caspases are generated by several stimuli including ligand-receptor interactions, growth factor deprivation, and inhibitors of cellular functions. All known caspases require cleavage adjacent to aspartates to liberate one large and one small subunit, which associate into an a2b2 tetramer to form the active enzyme. The gene for caspase-3, also known as yama, CPP32, and apopain, codes for a 32 kDa protein.{8444,18385,18386} Caspase-3 cleaves the death substrate poly(ADP-ribose) polymerase (PARP) to a specific 85 kDa form observed during apoptosis and is inhibitable by the CrmA protein. Other caspase-3 substrates include DNA-PK, actin, GAS2, procaspase-6, etc.{6292} Caspase-3 is activated by cleavage events at Asp28/Ser29 (between N-terminal pro-domain) and Asp175/Ser176 (between large and small subunits) to generate a large subunit of 17 kDa and a small subunit of 12 kDa.{18385}  

     

    Brand:
    Cayman
    SKU:13911 - 1 ea

    Available on backorder

  • Cayman’s Caspase-3/7 Fluorescence Assay Kit employs a specific substrate, N-Ac-DEVD-N’-MC-R110, which upon cleavage by active caspase-3 or caspase-7, generates a highly fluorescent product that can be measured using excitation and emission wavelengths of 485 and 535 nm, respectively. The kit is simple to use and can be easily adapted to high throughput screening for therapeutic compounds regulating activation of caspase-3 or -7. Active caspase-3 is included in the kit for use as a positive control. The caspase-3/7 inhibitor, N-Ac-DEVD-CHO, is also included in the kit for verifying the specificity of the substrate.  

     

    Brand:
    Cayman
    SKU:10009135 - 96 wells

    Available on backorder

  • Cayman’s Caspase-4 Inhibitor Screening Assay Kit provides a robust and easy-to-use platform for identifying novel inhibitors of human caspase-4, a major upstream effector of non-canonical inflammasome activation. The assay uses a caspase-4-specific fluorogenic substrate, Ac-LEVD-AFC. Caspase-4 cleaves this substrate generating free AFC, which can be easily quantified using a fluorescence plate reader at excitation and emission wavelengths of 400 and 505 nm, respectively. The potent and reversible caspase-4 inhibitor AC-LEVD-CHO is included as a positive control.  

     

    Brand:
    Cayman
    SKU:701820 - 384 wells

    Available on backorder

  • Cayman’s Caspase-6 Inhibitor Screening Assay Kit provides a robust and easy-to-use platform for identifying novel inhibitors of human caspase-6, a cysteine protease implicated in multiple neurodegenerative disorders. The assay uses a caspase-6-specific fluorogenic substrate, Z-VEID-AFC. Caspase-6 cleaves this substrate generating free AFC, which can be easily quantified using a fluorescence plate reader at excitation and emission wavelengths of 400 and 505 nm, respectively. The potent and reversible caspase-6 inhibitor Ac-VEID-CHO is included as a positive control and inhibits caspase-6 with an IC50 value of 12 nM.  

     

    Brand:
    Cayman
    SKU:701890 - 384 wells

    Available on backorder

  • Caspases are a family of cysteine proteases that are key mediators of programmed cell death or apoptosis.{18384} The precursor form of all caspases is composed of a prodomain and large and small catalytic subunits. The active forms of caspases are generated by several stimuli including ligand-receptor interactions, growth factor deprivation, and inhibitors of cellular functions. All known caspases require cleavage adjacent to aspartates to liberate one large and one small subunit, which associate into an a2b2 tetramer to form the active enzyme. Caspase-8 (FLICE) forms a direct link between the activation of CD95 and the caspase pathway. Overexpression of caspase-8 induces apoptosis, which can be blocked by inhibitors specific for the ICE family.  

     

    Brand:
    Cayman
    SKU:13913 - 1 ea

    Available on backorder

  • Caspase-9 and Apaf-1 bind to each other, which leads to caspase activation. Activated caspase-9 cleaves and activates caspase-3, one of the key proteases responsible for the proteolytic cleavage of many proteins in apoptosis. Caspase-9 plays a central role in cell death induced by a wide variety of apoptosis inducers including TNFa, TRAIL, anti-CD95, FADD, and TRADD. Caspase-9 is expressed in a variety of human tissues. Recently, a novel isoform of rat caspase-9 has been identified in which the C-terminus of full-length caspase-9 is replaced with an alternative peptide sequence. This protein, called Caspase-9 (CTD) (where CTD is carboxyl-terminal divergent) is expressed in multiple tissues, with the relative highest levels observed in ovary and heart. The variant C-terminus of CTD in rat is derived from an alternative exon of the rat caspase-9 gene. CTD was found primarily in the cytoplasm and was not detected in the nucleus. CTD proenzyme is not processed in the cells and lacks apoptotic activity. The CTD-transfected cells are resistant to caspase induction by cytochrome c, suggesting the CTD acts as a dominant-negative variant.  

     

    Brand:
    Cayman
    SKU:13915 - 1 ea

    Available on backorder

  • Apoptosis is related to many diseases and is induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases. A novel member in the caspase family was recently identified and designated ICE-LAP6, Mch6, and Apaf3.{6864,6865,6874} Caspase-9 and Apaf-1 bind to each other, which leads to caspase-9 activation.{6874} Caspase-9 is also activated by granzyme B and CPP32.{6864,6865} Activated caspase-9 cleaves and activates caspase-3, one of the key proteases responsible for the proteolytic cleavage of many key proteins in apoptosis.{6874} Caspase-9 plays a central role in cell death induced by a wide variety of apoptosis inducers including TNF-α, TRAIL, anti-CD-95, FADD, and TRADD.{6863} Caspase-9 is expressed in a variety of human tissues.{6864,6865}  

     

    Brand:
    Cayman
    SKU:160790 - 1 ea

    Available on backorder

  • Brand:
    Cayman
    SKU:707010 - 1 ea

    Available on backorder

  • Catalase (EC 1.11.1.6; 2H2O2 oxidoreductase) is an ubiquitous antioxidant enzyme that is present in most aerobic cells. Catalase (CAT) is involved in the detoxification of hydrogen peroxide (H2O2), a reactive oxygen species (ROS), which is a toxic product of both normal aerobic metabolism and pathogenic ROS production. This enzyme catalyzes the conversion of two molecules of H2O2 to molecular oxygen and two molecules of water (catalytic activity). CAT also demonstrates peroxidatic activity, in which low molecular weight alcohols can serve as electron donors. While the aliphatic alcohols serve as specific substrates for CAT, other enzymes with peroxidatic activity do not utilize these substrates. In humans, the highest levels of catalase are found in liver, kidney, and erythrocytes, where it is believed to account for the majority of hydrogen peroxide decomposition. The Cayman Chemical Catalase Assay Kit utilizes the peroxidatic function of CAT for determination of enzyme activity. The method is based on the reaction of the enzyme with methanol in the presence of an optimal concentration of H2O2. The formaldehyde produced is measured spectrophotometrically with 4-amino-3-hydrazino-5-mercapto-1,2,4-triazole (Purpald) as the chromogen.{9608,1446} Purpald specifically forms a bicyclic heterocycle with aldehydes, which upon oxidation changes from colorless to a purple color.{9608,1446} The assay can be used to measure CAT activity in plasma, serum, erythrocyte lysates, tissue homogenates, and cell lysates.  

     

    Brand:
    Cayman
    SKU:707002 - 480 wells

    Available on backorder

  • Catalase (EC 1.11.1.6; 2H2O2 oxidoreductase) is an ubiquitous antioxidant enzyme that is present in most aerobic cells. Catalase (CAT) is involved in the detoxification of hydrogen peroxide (H2O2), a reactive oxygen species (ROS), which is a toxic product of both normal aerobic metabolism and pathogenic ROS production. This enzyme catalyzes the conversion of two molecules of H2O2 to molecular oxygen and two molecules of water (catalytic activity). CAT also demonstrates peroxidatic activity, in which low molecular weight alcohols can serve as electron donors. While the aliphatic alcohols serve as specific substrates for CAT, other enzymes with peroxidatic activity do not utilize these substrates. In humans, the highest levels of catalase are found in liver, kidney, and erythrocytes, where it is believed to account for the majority of hydrogen peroxide decomposition. The Cayman Chemical Catalase Assay Kit utilizes the peroxidatic function of CAT for determination of enzyme activity. The method is based on the reaction of the enzyme with methanol in the presence of an optimal concentration of H2O2. The formaldehyde produced is measured spectrophotometrically with 4-amino-3-hydrazino-5-mercapto-1,2,4-triazole (Purpald) as the chromogen.{9608,1446} Purpald specifically forms a bicyclic heterocycle with aldehydes, which upon oxidation changes from colorless to a purple color.{9608,1446} The assay can be used to measure CAT activity in plasma, serum, erythrocyte lysates, tissue homogenates, and cell lysates.  

     

    Brand:
    Cayman
    SKU:707002 - 96 wells

    Available on backorder

  • Catalase (CAT) is a ubiquitous antioxidant enzyme involved in the detoxification of hydrogen peroxide (H2O2), a toxic product of both normal aerobic metabolism and pathogenic ROS production. It catalyzes the conversion of two molecules of H2O2 to molecular oxygen and two molecules of water (catalytic activity). CAT also demonstrates peroxidatic activity, in which low molecular weight alcohols can serve as electron donors. While aliphatic alcohols serve as specific substrates for CAT, other enzymes with peroxidatic activity do not utilize these substrates. Cayman’s Catalase Assay Kit utilizes the peroxidatic function of CAT for determination of enzyme activity in plasma, serum, erythrocyte lysates, tissue homogenates, and cell lysates. The method is based on the reaction of the enzyme with methanol in the presence of an optimal concentration of H2O2. The formaldehyde produced is measured colorimetrically with Purpald, a chromogen that specifically forms a bicyclic heterocycle with aldehydes, which upon oxidation changes from colorless to a purple color.  

     

    Brand:
    Cayman
    SKU:700910 - 480 wells

    Available on backorder

  • Catalase (CAT) is a ubiquitous antioxidant enzyme involved in the detoxification of hydrogen peroxide (H2O2), a toxic product of both normal aerobic metabolism and pathogenic ROS production. It catalyzes the conversion of two molecules of H2O2 to molecular oxygen and two molecules of water (catalytic activity). CAT also demonstrates peroxidatic activity, in which low molecular weight alcohols can serve as electron donors. While aliphatic alcohols serve as specific substrates for CAT, other enzymes with peroxidatic activity do not utilize these substrates. Cayman’s Catalase Assay Kit utilizes the peroxidatic function of CAT for determination of enzyme activity in plasma, serum, erythrocyte lysates, tissue homogenates, and cell lysates. The method is based on the reaction of the enzyme with methanol in the presence of an optimal concentration of H2O2. The formaldehyde produced is measured colorimetrically with Purpald, a chromogen that specifically forms a bicyclic heterocycle with aldehydes, which upon oxidation changes from colorless to a purple color.  

     

    Brand:
    Cayman
    SKU:700910 - 96 wells

    Available on backorder

  • Ion channels are integral membrane proteins that help establish and control the small voltage gradient across the plasma membrane of living cells by allowing the flow of ions down their electrochemical gradient.{17533} They are present in the membranes that surround all biological cells because their main function is to regulate the flow of ions across this membrane. Whereas some ion channels permit the passage of ions based on charge, others conduct based on a ionic species, such as sodium or potassium. Furthermore, in some ion channels, the passage is governed by a gate which is controlled by chemical or electrical signals, temperature, or mechanical forces. There are a few main classifications of gated ion channels. There are voltage-gated ion channels, ligand-gated, other gating systems, and finally those that are classified differently, having more exotic characteristics. The first are voltage-gated ion channels which open and close in response to membrane potential. These are then seperated into sodium, calcium, potassium, proton, transient receptor, and cyclic nucleotide-gated channels, each of which is responsible for a unique role. Ligand-gated ion channels are also known as ionotropic receptors, and they open in response to specific ligand molecules binding to the extracellular domain of the receptor protein. The other gated classifications include activation and inactivation by second messengers, inward-rectifier potassium channels, calcium-activated potassium channels, two-pore-domain potassium channels, light-gated channels, mechano-sensitive ion channels, and cyclic nucleotide-gated channels. Finally, the other classifications are based on less normal characteristics such as two-pore channels, and transient receptor potential channels.{17535} Specifically, Cav1.2 is a cardiac L-type calcium channel and is important for excitation and contraction of the heart.{17551} It may be associated with a variant of Long QT syndrome called Timothy’s syndrome{17552,17553} and also with Brugada syndrome. Some references also suggest it is related to bipolar disease as well.{17553}  

     

    Brand:
    Cayman
    SKU:13702 - 100 µg

    Available on backorder

  • Ion channels are integral membrane proteins that help establish and control the small voltage gradient across the plasma membrane of living cells by allowing the flow of ions down their electrochemical gradient.{17533} They are present in the membranes that surround all biological cells because their main function is to regulate the flow of ions across this membrane. Whereas some ion channels permit the passage of ions based on charge, others conduct based on a ionic species, such as sodium or potassium. Furthermore, in some ion channels, the passage is governed by a gate which is controlled by chemical or electrical signals, temperature, or mechanical forces. There are a few main classifications of gated ion channels. There are voltage-gated ion channels, ligand-gated, other gating systems, and finally those that are classified differently, having more exotic characteristics. The first are voltage-gated ion channels which open and close in response to membrane potential. These are then seperated into sodium, calcium, potassium, proton, transient receptor, and cyclic nucleotide-gated channels, each of which is responsible for a unique role. Ligand-gated ion channels are also known as ionotropic receptors, and they open in response to specific ligand molecules binding to the extracellular domain of the receptor protein. The other gated classifications include activation and inactivation by second messengers, inward-rectifier potassium channels, calcium-activated potassium channels, two-pore-domain potassium channels, light-gated channels, mechano-sensitive ion channels, and cyclic nucleotide-gated channels. Finally, the other classifications are based on less normal characteristics such as two-pore channels, and transient receptor potential channels.{17535} Specifically, Cav1.3, also known as the calcium channel, voltage-dependent, L type, α1D subunit (CACNA1D), is a human gene. Cav1.3 subunits are primarily expressed in neurons and neuroendocrine cells. Some studies suggest however that Cav1.3 is also found in the atria, and may figure prominently in atrial arrhythmias.{17540} Cav1.3 also carries the primary sensory receptors of the mammalian cochlea, and are also expressed in the electromotile outer hair cells.{17541}  

     

    Brand:
    Cayman
    SKU:13703 - 100 µg

    Available on backorder

  • Ion channels are integral membrane proteins that help establish and control the small voltage gradient across the plasma membrane of living cells by allowing the flow of ions down their electrochemical gradient.{17533} They are present in the membranes that surround all biological cells and their main function is to regulate the flow of ions across this membrane. Whereas some ion channels permit the passage of ions based on charge, others conduct based on a ionic species, such as sodium or potassium. Furthermore, in some ion channels, the passage is governed by a gate which is controlled by chemical or electrical signals, temperature, or mechanical forces. There are a few main classifications of gated ion channels. There are voltage-gated ion channels, ligand-gated, other gating systems, and finally those that are classified differently, having more exotic characteristics. The first are voltage-gated ion channels which open and close in response to membrane potential. These are then seperated into sodium, calcium, potassium, proton, transient receptor, and cyclic nucleotide-gated channels, each of which is responsible for a unique role. Ligand-gated ion channels are also known as ionotropic receptors and they open in response to specific ligand molecules binding to the extracellular domain of the receptor protein. The other gated classifications include activation and inactivation by second messengers, inward-rectifier potassium channels, calcium-activated potassium channels, two-pore-domain potassium channels, light-gated channels, mechano-sensitive ion channels, and cyclic nucleotide-gated channels. Finally, the other classifications are based on less normal characteristics such as two-pore channels and transient receptor potential channels.{17535} Cav1.3, also known as the calcium channel, voltage-dependent, L-type, α1D subunit (CACNA1D), is a human gene. Cav1.3 subunits are primarily expressed in neurons and neuroendocine cells. Some studies suggest however that Cav1.3 is also found in the atria and may figure prominently in atrial arrhythmias.{17540} Cav1.3 also carries the primary sensory receptors of the mammalian cochlea and are also expressed in the electromotile outer hair cells.{17541}  

     

    Brand:
    Cayman
    SKU:13706 - 100 µg

    Available on backorder

  • Ion channels are integral membrane proteins that help establish and control the small voltage gradient across the plasma membrane of living cells by allowing the flow of ions down their electrochemical gradient.{17533} They are present in the membranes that surround all biological cells and their main function is to regulate the flow of ions across this membrane. Whereas some ion channels permit the passage of ions based on charge, others conduct based on a ionic species, such as sodium or potassium. Furthermore, in some ion channels, the passage is governed by a gate which is controlled by chemical or electrical signals, temperature, or mechanical forces. There are a few main classifications of gated ion channels. There are voltage-gated ion channels, ligand-gated, other gating systems, and finally those that are classified differently, having more exotic characteristics. The first are voltage-gated ion channels which open and close in response to membrane potential. These are then seperated into sodium, calcium, potassium, proton, transient receptor, and cyclic nucleotide-gated channels, each of which is responsible for a unique role. Ligand-gated ion channels are also known as ionotropic receptors and they open in response to specific ligand molecules binding to the extracellular domain of the receptor protein. The other gated classifications include activation and inactivation by second messengers, inward-rectifier potassium channels, calcium-activated potassium channels, two-pore-domain potassium channels, light-gated channels, mechano-sensitive ion channels, and cyclic nucleotide-gated channels. Finally, the other classifications are based on less normal characteristics such as two-pore channels and transient receptor potential channels.{17535} Cav3.2 is a protein which in humans is encoded by the CACNA1H gene. Studies suggest certain mutations in this gene lead to childhood absence epilepsy.{17596,17598} Studies also suggest that the up-regulations of Cav3.2 may participate in the progession of prostate cancer toward an androgen-independent stage.{17599}  

     

    Brand:
    Cayman
    SKU:13704 - 100 µg

    Available on backorder

  • Ion channels are integral membrane proteins that help establish and control the small voltage gradient across the plasma membrane of living cells by allowing the flow of ions down their electrochemical gradient.{17533} They are present in the membranes that surround all biological cells because their main function is to regulate the flow of ions across this membrane. Whereas some ion channels permit the passage of ions based on charge, others conduct based on a ionic species, such as sodium or potassium. Furthermore, in some ion channels, the passage is governed by a gate which is controlled by chemical or electrical signals, temperature, or mechanical forces. There are a few main classifications of gated ion channels. There are voltage-gated ion channels, ligand-gated, other gating systems, and finally those that are classified differently, having more exotic characteristics. The first are voltage-gated ion channels which open and close in response to membrane potential. These are then spearated into sodium, calcium, potassium, proton, transient receptor, and cyclic nucleotide-gated channels, each of which is responsible for a unique role. Ligand-gated ion channels are also known as ionotropic receptors, and they open in response to specific ligand molecules binding to the extracellular domain of the receptor protein. The other gated classifications include activation and inactivation by second messengers, inward-rectifier potassium channels, calcium-activated potassium channels, two-pore-domain potassium channels, light-gated channels, mechano-sensitive ion channels, and cyclic nucleotide-gated channels. Finally, the other classifications are based on less normal characteristics such as two-pore channels, and transient receptor potential channels.{17535} Calcium channel, voltage-dependent, β1 subunit, also known as CACNB1, is a human gene. The protein encoded by this gene belongs to the calcium channel β subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the α1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.{17535,17536}  

     

    Brand:
    Cayman
    SKU:13700 - 100 µg

    Available on backorder

  • Ion channels are integral membrane proteins that help establish and control the small voltage gradient across the plasma membrane of living cells by allowing the flow of ions down their electrochemical gradient.{17533} They are present in the membranes that surround all biological cells because their main function is to regulate the flow of ions across this membrane. Whereas some ion channels permit the passage of ions based on charge, others conduct based on a ionic species, such as sodium or potassium. Furthermore, in some ion channels, the passage is governed by a gate which is controlled by chemical or electrical signals, temperature, or mechanical forces. There are a few main classifications of gated ion channels. There are voltage-gated ion channels, ligand-gated, other gating systems, and finally those that are classified differently, having more exotic characteristics. The first are voltage-gated ion channels which open and close in response to membrane potential. These are then seperated into sodium, calcium, potassium, proton, transient receptor, and cyclic nucleotide-gated channels, each of which is responsible for a unique role. Ligand-gated ion channels are also known as ionotropic receptors, and they open in response to specific ligand molecules binding to the extracellular domain of the receptor protein. The other gated classifications include activation and inactivation by second messengers, inward-rectifier potassium channels, calcium-activated potassium channels, two-pore-domain potassium channels, light-gated channels, mechano-sensitive ion channels, and cyclic nucleotide-gated channels. Finally, the other classifications are based on less normal characteristics such as two-pore channels, and transient receptor potential channels.{17535} Specifically, this gene encodes a member of the β subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of α1, α3/δ, β, and γ subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. The protein described in this record plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the a1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME). Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized.{17542,17543}  

     

    Brand:
    Cayman
    SKU:13701 - 100 µg

    Available on backorder

  • This assay has been developed for researchers that do not have experience performing enzyme immunoassays (ELISA’s). It can be used as a practice tool allowing you to become comfortable with running Cayman ELISA’s. Practicing these assays can help to decrease errors when samples, time, and costs are at risk. This kit contains enough reagents to run at least four complete standard curves, including blank wells, NSB wells, and maximum binding (B0) wells. For more information regarding the development and science behind the manufacturing of ELISA’s please contact our technical service department.  

     

    Brand:
    Cayman
    SKU:10009658 - 96 wells

    Available on backorder