Anti-EP4 (Prostaglandin E4) receptor (C-term) conjugated to SureLight® APC Antibody: Rabbit anti-EP4 receptor (C-term) IgG Specificity: EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Reactivity: Human, murine, rat, and ovine EP4 receptor; non-reactive with EP1, EP2, and EP3 receptors; other species not tested. Dye: SureLight® Allophycocyanin (APC) Excitation max. λ: 650 nm Emission max. λ: 660 nm Uses: Flow cytometry and cell-based assays
Available on backorder
Synonyms:
Immunogen:
Formulation: Lyophilized
Isotype:
Applications:
Origin:
Stability: 90 days
Application|Cell-Based Assay||Application|Flow Cytometry||Product Type|Antibodies|Secondary Antibodies||Research Area|Lipid Biochemistry|Cyclooxygenase Pathway
For the quantitation of Rat Bdnf concentrations in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA, citrate).
Available on backorder
For the quantitation of Human PTX3 concentrations in cell culture supernates, serum, plasma(EDTA) and saliva.
Available on backorder
For the quantitation of Mouse Tnf concentrations in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
Available on backorder
